Symbol:
Adamts13
Name:
ADAM metallopeptidase with thrombospondin type 1 motif 13
RGD ID:
12618863
Description:
ENCODES a protein that exhibits endopeptidase activity (ortholog); peptidase activity (ortholog); INVOLVED IN cellular response to interleukin-4 (ortholog); cellular response to lipopolysaccharide (ortholog); cellular response to tumor necrosis factor (ortholog); ASSOCIATED WITH atypical hemolytic-uremic syndrome (ortholog); autoimmune thrombocytopenic purpura (ortholog); cholestasis (ortholog); FOUND IN extracellular space (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
A disintegrin and metalloproteinase with thrombospondin motifs 13
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
SpeTri2.0 - Squirrel SpeTri2.0 Assembly
Position:
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 199,894,464 - 199,925,811 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936669 3,456,494 - 3,478,512 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936669 3,449,259 - 3,478,471 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Adamts13 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 199,894,464 - 199,925,811 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936669 3,456,494 - 3,478,512 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936669 3,449,259 - 3,478,471 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ADAMTS13 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 133,414,337 - 133,459,386 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 133,414,358 - 133,459,402 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 136,279,457 - 136,324,508 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 135,276,941 - 135,314,328 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 133,316,673 - 133,344,631 NCBI Celera 9 106,830,032 - 106,875,101 (+) NCBI Celera Cytogenetic Map 9 q34.2 NCBI HuRef 9 105,781,289 - 105,826,219 (+) NCBI HuRef CHM1_1 9 136,429,966 - 136,475,028 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 145,628,765 - 145,673,828 (+) NCBI T2T-CHM13v2.0
Adamts13 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 26,863,363 - 26,899,638 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 26,863,428 - 26,899,640 (+) Ensembl GRCm39 Ensembl GRCm38 2 26,973,361 - 27,009,625 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 26,973,416 - 27,009,628 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 26,828,936 - 26,865,145 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 26,795,546 - 26,831,456 (+) NCBI MGSCv36 mm8 Celera 2 26,682,908 - 26,716,063 (+) NCBI Celera Cytogenetic Map 2 A3 NCBI cM Map 2 19.14 NCBI
Adamts13 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 30,697,354 - 30,736,539 (+) NCBI GRCr8 mRatBN7.2 3 10,299,264 - 10,338,464 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 10,300,028 - 10,346,687 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 3 5,519,921 - 5,558,390 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 5,519,990 - 5,558,166 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 10,881,333 - 10,920,130 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 5,868,906 - 5,908,061 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 3 5,098,096 - 5,136,496 (+) NCBI Celera Cytogenetic Map 3 p12 NCBI
Adamts13 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955513 2,764,186 - 2,786,187 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955513 2,761,386 - 2,786,447 (+) NCBI ChiLan1.0 ChiLan1.0
ADAMTS13 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 5,894,039 - 5,935,236 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 5,896,355 - 5,937,896 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 104,541,051 - 104,582,574 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 133,163,788 - 133,193,913 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 133,156,761 - 133,193,707 (+) Ensembl panpan1.1 panPan2
ADAMTS13 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 49,839,252 - 49,867,295 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 49,839,252 - 49,867,295 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 49,120,490 - 49,148,471 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 50,710,574 - 50,741,239 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 50,710,605 - 50,741,236 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 49,475,353 - 49,503,303 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 49,816,885 - 49,845,047 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 49,895,000 - 49,923,185 (+) NCBI UU_Cfam_GSD_1.0
ADAMTS13 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 273,024,009 - 273,056,039 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 273,022,014 - 273,066,916 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 306,995,806 - 307,029,855 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ADAMTS13 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 4,677,237 - 4,718,825 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 4,677,229 - 4,714,386 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666058 270,510 - 311,999 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Adamts13
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSSTOT00000003787 ⟹ ENSSTOP00000003393
Type:
CODING
Position:
Squirrel Assembly Chr Position (strand) Source SpeTri2.0 Ensembl NW_004936669 3,456,494 - 3,478,512 (-) Ensembl
RefSeq Acc Id:
XM_005337003 ⟹ XP_005337060
Type:
CODING
Position:
Squirrel Assembly Chr Position (strand) Source HiC_Itri_2 NW_024404947 199,894,464 - 199,925,811 (+) NCBI SpeTri2.0 NW_004936669 3,449,259 - 3,478,471 (-) NCBI
Sequence:
CATGGCTGGTGTCAGGGGAGTCCTTGCTGGTGCCTTCTTTGTCCTGGGCTGCTTGGCACTCTCCGTTTTCCAGCAGAACTTTCTTGAGGCCCTGGAGCCCAAGGACCTGGCTTCTTACTTTGGCCCCA
hide sequence
RefSeq Acc Id:
XP_005337060 ⟸ XM_005337003
- Sequence:
MAGVRGVLAGAFFVLGCLALSVFQQNFLEALEPKDLASYFGPSATFEGRPSPRLQRRRRAVGGTLHLELLVAVGPDVHQAHQEDTERYILTNLNIGSELLRDPSLGAQFRVHLVKLIILTETKDAPNI
hide sequence
Ensembl Acc Id:
ENSSTOP00000003393 ⟸ ENSSTOT00000003787
