Symbol:
Tnp2
Name:
transition protein 2
RGD ID:
11438
MGI Page
MGI
Description:
Predicted to enable zinc ion binding activity. Involved in positive regulation of protein processing and sperm DNA condensation. Acts upstream of or within several processes, including binding activity of sperm to zona pellucida; flagellated sperm motility; and penetration of zona pellucida. Located in male germ cell nucleus. Part of nucleosome. Is expressed in spermatid and testis. Orthologous to human TNP2 (transition protein 2).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
nuclear transition protein 2; TP; Tp-; Tp-2; TP2; transition protein 2 (alt.)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 10,605,799 - 10,606,519 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 10,605,800 - 10,606,524 (-) Ensembl GRCm39 Ensembl GRCm38 16 10,787,935 - 10,788,655 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 10,787,936 - 10,788,660 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 10,788,028 - 10,788,748 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 10,701,513 - 10,702,233 (-) NCBI MGSCv36 mm8 Celera 16 11,415,373 - 11,416,093 (-) NCBI Celera Cytogenetic Map 16 A1 NCBI cM Map 16 5.83 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Tnp2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 10,605,799 - 10,606,519 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 10,605,800 - 10,606,524 (-) Ensembl GRCm39 Ensembl GRCm38 16 10,787,935 - 10,788,655 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 10,787,936 - 10,788,660 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 10,788,028 - 10,788,748 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 10,701,513 - 10,702,233 (-) NCBI MGSCv36 mm8 Celera 16 11,415,373 - 11,416,093 (-) NCBI Celera Cytogenetic Map 16 A1 NCBI cM Map 16 5.83 NCBI
TNP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 11,267,857 - 11,269,325 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 11,267,748 - 11,269,533 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 11,361,714 - 11,363,182 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 11,269,215 - 11,270,661 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 11,269,214 - 11,270,661 NCBI Celera 16 11,531,105 - 11,532,551 (-) NCBI Celera Cytogenetic Map 16 p13.13 NCBI HuRef 16 11,279,446 - 11,280,892 (-) NCBI HuRef CHM1_1 16 11,361,620 - 11,363,066 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 11,304,079 - 11,305,547 (-) NCBI T2T-CHM13v2.0
Tnp2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 5,386,735 - 5,387,463 (+) NCBI GRCr8 mRatBN7.2 10 4,879,812 - 4,880,540 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 4,879,812 - 4,880,538 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 9,576,387 - 9,577,115 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 9,097,503 - 9,098,231 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 4,735,784 - 4,736,512 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 4,953,898 - 4,954,626 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 4,953,879 - 4,954,624 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 3,780,384 - 3,781,112 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 4,816,612 - 4,817,340 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 4,816,611 - 4,817,338 (+) NCBI Celera 10 3,901,408 - 3,902,136 (+) NCBI Celera Cytogenetic Map 10 q11 NCBI
Tnp2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955442 7,311,826 - 7,314,046 (+) NCBI ChiLan1.0 ChiLan1.0
TNP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 11,817,009 - 11,819,356 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 15,587,457 - 15,589,800 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 10,209,801 - 10,211,466 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 11,431,694 - 11,433,158 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 11,431,822 - 11,433,087 (-) Ensembl panpan1.1 panPan2
TNP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 31,498,361 - 31,498,740 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 31,426,715 - 31,499,842 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 32,881,238 - 32,881,617 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 31,680,942 - 31,682,492 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 6 31,494,292 - 31,494,671 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 31,368,582 - 31,368,961 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 31,792,757 - 31,794,307 (+) NCBI UU_Cfam_GSD_1.0
TNP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 31,870,068 - 31,871,702 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 31,868,517 - 31,871,530 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 32,659,663 - 32,661,176 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 3 p13-cent NCBI
TNP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 10,744,762 - 10,746,244 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 10,744,915 - 10,746,159 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 19,417,005 - 19,418,243 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tnp2
.
Predicted Target Of
Count of predictions: 92 Count of miRNA genes: 85 Interacting mature miRNAs: 91 Transcripts: ENSMUST00000051297 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301970 Heal11_m wound healing/regeneration 11 (mouse) Not determined 16 1 24263853 Mouse 26884376 Skwq4_m skull length QTL 4, 5 week (mouse) 16 8417864 90896888 Mouse 4142460 Nilac10_m nicotine induced locomotor activity 10 (mouse) Not determined 16 7136906 29225471 Mouse 38501069 Tip4_m tuberculosis immunophenotype 4, IFN-g level (mouse) 16 4317864 44520363 Mouse 1302106 Rapop1_m radiation-induced apoptosis 1 (mouse) Not determined 16 3780779 15731053 Mouse 26884432 Zlq7_m zygomatic length QTL 7, 10 week (mouse) 16 3817864 64620363 Mouse 1300632 Loca2_m locomotor activity 2 (mouse) Not determined 16 1 22500574 Mouse 1357658 Dice1a_m determination of interleukin 4 commitment 1a (mouse) Not determined 16 7801100 10957706 Mouse 27226768 Tibl9_m tibia length 9, 5 week (mouse) 16 3317864 51420363 Mouse 1301443 Mopkd2_m modifier of polycystic kidney disease progression 2 (mouse) Not determined 16 4646314 38646414 Mouse 10043978 Obq35_m obesity QTL 35 (mouse) Not determined 16 9881631 43881631 Mouse 1301575 Tanidd3_m tally ho associated non-insulin dependednt diabetes mellitus 3 (mouse) Not determined 16 1 22897739 Mouse 1357763 Lp1_m lymphocyte proliferation 1 (mouse) Not determined 16 6542979 65466552 Mouse 1301384 Dice1_m determination of interleukin 4 commitment 1 (mouse) Not determined 16 1 28434358 Mouse 1300943 Skts9_m skin tumor susceptibility 9 (mouse) Not determined 16 5775252 39775440 Mouse 10402497 Lmr23_m leishmaniasis resistance 23 (mouse) Not determined 16 1 29674200 Mouse 10412289 Ppsl_m plasma P-selectin levels (mouse) Not determined 16 1 30814572 Mouse 4141468 Nhdlq10_m non-HDL QTL 10 (mouse) Not determined 16 1 24263853 Mouse 1300656 Bgeq15_m body growth early QTL 15 (mouse) Not determined 16 5775252 39775440 Mouse 1301559 Bbaa19_m B.burgdorferi-associated arthritis 19 (mouse) Not determined 16 1 30066977 Mouse 11251724 Ewc6_m ethanol withdrawal and consumption 6 (mouse) 16 8226052 42226052 Mouse 1300987 Skull23_m skull morphology 23 (mouse) Not determined 16 5775252 39775440 Mouse 1301945 Skl7_m skeletal size (tail length) 7 (mouse) Not determined 16 5775252 39775440 Mouse 4141010 Bbq1_m brain and behavior QTL 1 (mouse) Not determined 16 6477009 35021216 Mouse 27095908 Scvln7_m sacral vertebrae length 2, 5 week (mouse) 16 3317864 39820362 Mouse 4141060 Pbwg19_m postnatal body weight growth 19 (mouse) Not determined 16 1 20780888 Mouse 13432183 Rotse3_m rotarod training saline/ethanol 3 (mouse) 16 9917771 10617771 Mouse 10043879 Adip25_m adiposity 25 (mouse) Not determined 16 1 22520318 Mouse 27226785 Feml12_m femur length 12, 5 week (mouse) 16 3317864 64620363 Mouse
Tnp2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 16 B1-B3 UniSTS cM Map 16 3.4 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000051297 ⟹ ENSMUSP00000053078
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 16 10,605,800 - 10,606,524 (-) Ensembl GRCm38.p6 Ensembl 16 10,787,936 - 10,788,660 (-) Ensembl
RefSeq Acc Id:
NM_013694 ⟹ NP_038722
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 16 10,605,799 - 10,606,519 (-) NCBI GRCm38 16 10,787,935 - 10,788,655 (-) ENTREZGENE MGSCv37 16 10,788,028 - 10,788,748 (-) RGD Celera 16 11,415,373 - 11,416,093 (-) RGD cM Map 16 ENTREZGENE
Sequence:
GGGCCTGCTGGGAGGAGGAGGAGGAGGAAGTCTCTGCCCCGAGTGTGGCCTCCCATGGACACCAAGATGCAGAGCCTTCCCACCACTCATCCCCACCCCCACAGCTCCTCGCGGCCTCAAAGTCACAC
hide sequence
RefSeq Acc Id:
NP_038722 ⟸ NM_013694
- UniProtKB:
Q91XK4 (UniProtKB/Swiss-Prot), P11378 (UniProtKB/Swiss-Prot)
- Sequence:
MDTKMQSLPTTHPHPHSSSRPQSHTSNQCNQCTCSHHCRSCSQAGHAGSSSSPSPGPPMKHPKPSVHSRHSPARPSHRGSCPKNRKTFEGKVSKRKAVRRRKRTHRAKRRSSGRRYK
hide sequence
Ensembl Acc Id:
ENSMUSP00000053078 ⟸ ENSMUST00000051297
RGD ID: 8685434 Promoter ID: EPDNEW_M20747 Type: multiple initiation site Name: Tnp2_1 Description: Mus musculus transition protein 2 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 16 10,788,661 - 10,788,721 EPDNEW
RGD ID: 6849416 Promoter ID: EP33024 Type: single initiation site Name: MM_STP2 Description: Nuclear transition protein 2, TNP2 gene. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Notes: homology_group=Homology group 193; Mammalian transition protein 2 Tissues & Cell Lines: spermatids Experiment Methods: Nuclease protection Position: Mouse Assembly Chr Position (strand) Source MGSCv37 16 10,788,754 - 10,788,814 EPD MGSCv36 16 10,788,754 - 10,788,814 EPD
