Symbol:
Tacr3
Name:
tachykinin receptor 3
RGD ID:
11380
MGI Page
MGI
Description:
Predicted to enable tachykinin receptor activity. Predicted to be involved in several processes, including positive regulation of flagellated sperm motility; positive regulation of uterine smooth muscle contraction; and response to estradiol. Predicted to be located in dendrite membrane and neuronal cell body membrane. Predicted to be active in plasma membrane and sperm midpiece. Is expressed in several structures, including alimentary system; genitourinary system; integumental system; nervous system; and sensory organ. Used to study hypogonadotropic hypogonadism 11 with or without anosmia. Human ortholog(s) of this gene implicated in hypogonadotropic hypogonadism 11 with or without anosmia. Orthologous to human TACR3 (tachykinin receptor 3).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
neurokinin 3 receptor; neurokinin B receptor; neuromedin K receptor; neuromedin-K receptor; Nk; NK-3 receptor; Nk3 receptor; Nk3r; Nkr; Tac; Tac3r
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TACR3 (tachykinin receptor 3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Tacr3 (tachykinin receptor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tacr3 (tachykinin receptor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TACR3 (tachykinin receptor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TACR3 (tachykinin receptor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TACR3 (tachykinin receptor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TACR3 (tachykinin receptor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tacr3 (tachykinin receptor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tacr3 (tachykinin receptor 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TACR3 (tachykinin receptor 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tacr3l (tachykinin receptor 3-like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
tacr3a (tachykinin receptor 3a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
tkr-1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
tkr-2
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
TkR99D
Alliance
DIOPT (Hieranoid|InParanoid|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tacr3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 134,534,768 - 134,640,342 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 134,534,768 - 134,640,340 (+) Ensembl GRCm39 Ensembl GRCm38 3 134,829,007 - 134,934,581 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 134,829,007 - 134,934,579 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 134,491,971 - 134,597,545 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 134,766,394 - 134,871,959 (+) NCBI MGSCv36 mm8 Celera 3 141,238,671 - 141,345,575 (+) NCBI Celera Cytogenetic Map 3 G3 NCBI cM Map 3 62.47 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
1.
Evidence for mediation of nociception by injection of the NK-3 receptor agonist, senktide, into the dorsal periaqueductal gray of rats.
Bassi GS, etal., Psychopharmacology (Berl). 2008 Dec 18.
2.
The tachykinin receptor 3 is associated with alcohol and cocaine dependence.
Foroud T, etal., Alcohol Clin Exp Res. 2008 Jun;32(6):1023-30. doi: 10.1111/j.1530-0277.2008.00663.x. Epub 2008 Apr 15.
3.
Blockade of NK3R signaling in the PVN decreases vasopressin and oxytocin release and c-Fos expression in the magnocellular neurons in response to hypotension.
Haley GE and Flynn FW, Am J Physiol Regul Integr Comp Physiol. 2008 Oct;295(4):R1158-67. Epub 2008 Jul 23.
4.
Time-dependent changes in neurokinin(3) receptors and tachykinins during adjuvant-induced peripheral inflammation in the rat.
Linden DR, etal., Neuroscience. 2000;98(4):801-11.
5.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
6.
MGDs mouse GO annotations
MGD data from the GO Consortium
7.
Cardiovascular roles of tachykinin peptides in the nucleus tractus solitarii of rats.
Nagashima A, etal., Brain Res. 1989 May 22;487(2):392-6.
8.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Kainic acid induced seizures cause a marked increase in the expression of neurokinin-3 receptor mRNA in the rat cerebellum.
Roder C, etal., Neurosci Lett. 1994 Nov 7;181(1-2):158-60.
14.
Prenatal Exposure to Methamphetamine: Up-Regulation of Brain Receptor Genes.
Zoubková H, etal., Front Neurosci. 2019 Aug 1;13:771. doi: 10.3389/fnins.2019.00771. eCollection 2019.
Tacr3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 134,534,768 - 134,640,342 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 134,534,768 - 134,640,340 (+) Ensembl GRCm39 Ensembl GRCm38 3 134,829,007 - 134,934,581 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 134,829,007 - 134,934,579 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 134,491,971 - 134,597,545 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 134,766,394 - 134,871,959 (+) NCBI MGSCv36 mm8 Celera 3 141,238,671 - 141,345,575 (+) NCBI Celera Cytogenetic Map 3 G3 NCBI cM Map 3 62.47 NCBI
TACR3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 103,586,031 - 103,719,985 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 103,586,031 - 103,719,985 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 104,507,188 - 104,641,142 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 104,730,074 - 104,860,422 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 104,868,228 - 104,998,577 NCBI Celera 4 101,809,125 - 101,939,478 (-) NCBI Celera Cytogenetic Map 4 q24 NCBI HuRef 4 100,245,509 - 100,375,866 (-) NCBI HuRef CHM1_1 4 104,487,252 - 104,617,580 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 106,897,954 - 107,031,922 (-) NCBI T2T-CHM13v2.0
Tacr3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 225,940,497 - 226,037,756 (+) NCBI GRCr8 mRatBN7.2 2 223,266,536 - 223,363,791 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 223,266,536 - 223,363,791 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 230,969,011 - 231,055,530 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 228,868,726 - 228,955,238 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 223,733,543 - 223,820,045 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 240,021,152 - 240,118,971 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 240,021,152 - 240,118,971 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 258,547,661 - 258,644,112 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 232,309,015 - 232,404,964 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 232,295,754 - 232,391,704 (+) NCBI Celera 2 215,485,216 - 215,569,645 (+) NCBI Celera Cytogenetic Map 2 q43 NCBI
Tacr3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955496 5,151,668 - 5,222,624 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955496 5,152,134 - 5,222,565 (+) NCBI ChiLan1.0 ChiLan1.0
TACR3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 101,649,480 - 101,782,419 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 101,936,181 - 102,074,800 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 96,022,788 - 96,162,249 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 106,644,943 - 106,776,172 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 106,644,943 - 106,776,172 (-) Ensembl panpan1.1 panPan2
TACR3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 24,812,344 - 24,888,452 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 24,812,119 - 24,907,580 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 17,136,602 - 17,213,041 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 25,029,113 - 25,105,792 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 25,028,888 - 25,106,462 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 25,048,235 - 25,126,781 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 24,791,973 - 24,868,622 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 14,994,194 - 15,070,872 (+) NCBI UU_Cfam_GSD_1.0
TACR3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 117,662,122 - 117,721,613 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 117,662,122 - 117,718,317 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 126,511,759 - 126,570,636 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TACR3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 51,662,248 - 51,764,058 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 51,665,147 - 51,762,390 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 30,211,968 - 30,313,605 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tacr3
.
Predicted Target Of
Count of predictions: 565 Count of miRNA genes: 412 Interacting mature miRNAs: 453 Transcripts: ENSMUST00000029822 Prediction methods: Miranda Result types: miRGate_prediction
1300753 Eae10_m susceptibility to experimental allergic encephalomyelitis 10 (mouse) Not determined 3 131736617 148451178 Mouse 1300752 Ap6q_m alcohol preference 6 QTL (mouse) Not determined 3 100372912 147045722 Mouse 1558868 Ses9_m salmonella enteritidis susceptibility 9 (mouse) Not determined 3 119057332 153057456 Mouse 26884382 Bzwq1_m bi-zygomatic width QTL 1, 5 week (mouse) 3 52207421 137205761 Mouse 10412120 Ccs3_m colon cancer susceptibility 3 (mouse) Not determined 3 131754536 146017669 Mouse 12910796 Pwbwq6_m post-weaning body weight QTL 6 (mouse) 3 110084357 135715812 Mouse 11039523 Tbbr1_m Trypanosoma brucei brucei response 1 (mouse) 3 130849375 159745316 Mouse 1301528 Loco1_m locomotor activity 1 (mouse) Not determined 3 133461893 159745316 Mouse 12910793 Pwbwq7_m post-weaning body weight QTL 7 (mouse) 3 110084357 135715812 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 4142449 Tgq14_m triglyceride QTL 14 (mouse) Not determined 119318586 153318586 Mouse 10412240 Alpq6_m alcohol preference QTL 6 (mouse) Not determined 3 120772078 154772078 Mouse 4141935 Tgq15_m triglyceride QTL 15 (mouse) Not determined 119318586 153318586 Mouse 1302151 Lprm2_m lymphoproliferation modifier 2 (mouse) Not determined 3 119778857 153779044 Mouse 1301381 Bomb1_m bone marrow pre-B 1 (mouse) Not determined 3 111133243 145133417 Mouse 10043919 Afpq8_m abdominal fat percent QTL 8 (mouse) Not determined 3 119057332 153057456 Mouse 1300619 Cdcs1_m cytokine deficiency colitis susceptibility 1 (mouse) Not determined 3 109834882 143835005 Mouse 26884419 Bzwq6_m bi-zygomatic width QTL 6, 10 week (mouse) 3 100607316 137205761 Mouse 1301705 Sles3_m systemic lupus erythmatosus suppressor 3 (mouse) Not determined 3 37174862 143353183 Mouse 12910815 Ogrq1_m overall growth rate QTL 1 (mouse) 3 110084357 135715812 Mouse 4142245 Pstc1_m periosteal circumference 1 (mouse) Not determined 3 126270248 159745316 Mouse 4142178 Ctrq2_m C. trachomatis resistance QTL 2 (mouse) Not determined 3 89139967 137453008 Mouse 1302093 Orgwq5_m organ weight QTL 5 (mouse) Not determined 3 107376936 147304689 Mouse 26884415 Bzwq11_m bi-zygomatic width QTL 11, 16 week (mouse) 3 124993649 137205761 Mouse 1301563 Alcp3_m alcohol preference locus 3 (mouse) Not determined 3 130736935 159745316 Mouse 1301347 Fpli_m fasting plasma insulin (mouse) Not determined 3 126460514 159745316 Mouse 1301218 Letohc1_m low ethanol consumption 1 (mouse) Not determined 3 126352986 159745316 Mouse 27226733 Tibmd6_m tibia midshaft diameter 6, 16 week (mouse) 3 101307316 149805637 Mouse 27226732 Tibmd3_m tibia midshaft diameter 3, 10 week (mouse) 3 96607316 147805636 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 1301805 Mors2_m modifier of obesity related sterility 2 (mouse) Not determined 3 103482659 137482783 Mouse 1301100 Bdt2_m bone density traits 2 (mouse) Not determined 3 114736617 148736784 Mouse
Tacr3
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 3 H2 UniSTS cM Map UN UniSTS cM Map 3 UniSTS
Tacr3
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 3 H2 UniSTS cM Map UN UniSTS cM Map 3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000029822 ⟹ ENSMUSP00000029822
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 134,534,768 - 134,640,340 (+) Ensembl GRCm38.p6 Ensembl 3 134,829,007 - 134,934,579 (+) Ensembl
RefSeq Acc Id:
NM_021382 ⟹ NP_067357
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 134,534,768 - 134,640,342 (+) NCBI GRCm38 3 134,829,007 - 134,934,581 (+) ENTREZGENE MGSCv37 3 134,491,971 - 134,597,545 (+) RGD Celera 3 141,238,671 - 141,345,575 (+) RGD cM Map 3 ENTREZGENE
Sequence:
GCTCTCCTGCTGCTGCCTGGGAGCTCCTCCCTGGCAGGACCCAAGCGAGGAGTCTGGTTCTTTCCTGCCCAGCAAACTCCCAGGAGTGAGGCTCCAGCTCTGCAGCCTTTGCCCCACAACCGCATCCC
hide sequence
RefSeq Acc Id:
NP_067357 ⟸ NM_021382
- UniProtKB:
Q8BL44 (UniProtKB/Swiss-Prot), Q61968 (UniProtKB/Swiss-Prot), Q9JKN0 (UniProtKB/Swiss-Prot), P47937 (UniProtKB/Swiss-Prot), Q6NXX1 (UniProtKB/TrEMBL)
- Sequence:
MASVPTGENWTDGTAGVGSHTGNLSAALGITEWLALQAGNFSSALGLPVTSQAPSQVRANLTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASVAAFNTLV
hide sequence
Ensembl Acc Id:
ENSMUSP00000029822 ⟸ ENSMUST00000029822
RGD ID: 6834523 Promoter ID: MM_KWN:36156 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lung Transcripts: NM_021382 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 134,491,741 - 134,492,241 (+) MPROMDB
RGD ID: 6882416 Promoter ID: EPDNEW_M4659 Type: single initiation site Name: Tacr3_1 Description: Mus musculus tachykinin receptor 3 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 134,829,007 - 134,829,067 EPDNEW
