Tacr3 (tachykinin receptor 3) - Rat Genome Database

Name: Tacr3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tacr3 (tachykinin receptor 3) Rattus norvegicus

Analyze

Symbol:

Tacr3

Name:

tachykinin receptor 3

RGD ID:

3810

Description:

Enables tachykinin receptor activity. Involved in several processes, including positive regulation of uterine smooth muscle contraction; regulation of dopamine metabolic process; and response to estradiol. Located in dendrite membrane and neuronal cell body membrane. Used to study hypertension. Biomarker of visual epilepsy. Human ortholog(s) of this gene implicated in hypogonadotropic hypogonadism 11 with or without anosmia. Orthologous to human TACR3 (tachykinin receptor 3); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH 3,4-methylenedioxymethamphetamine; 6-propyl-2-thiouracil; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

neurokinin B receptor; neuromedin K receptor; neuromedin K receptor (neurokinin B/tachikin 3); neuromedin-K receptor; NK-3 receptor; NK-3R; Nkr; Nmkr; Tac3r; tachikin receptor 3

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TACR3 (tachykinin receptor 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tacr3 (tachykinin receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tacr3 (tachykinin receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TACR3 (tachykinin receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TACR3 (tachykinin receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TACR3 (tachykinin receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TACR3 (tachykinin receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tacr3 (tachykinin receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ARF4 (ADP ribosylation factor 4)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Tacr3 (tachykinin receptor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TACR3 (tachykinin receptor 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tacr3l (tachykinin receptor 3-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tacr3a (tachykinin receptor 3a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tkr-1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	tkr-2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	TkR99D	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tacr3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Candidate Gene For:

Eau5

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	223,266,536 - 223,363,791 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	223,266,536 - 223,363,791 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	230,969,011 - 231,055,530 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	228,868,726 - 228,955,238 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	223,733,543 - 223,820,045 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	240,021,152 - 240,118,971 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	240,021,152 - 240,118,971 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	258,547,661 - 258,644,112 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	232,309,015 - 232,404,964 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	232,295,754 - 232,391,704 (+)	NCBI
Celera	2	215,485,216 - 215,569,645 (+)	NCBI		Celera
Cytogenetic Map	2	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alcohol use disorder (ISO)

amenorrhea (ISO)

autism spectrum disorder (ISO)

beta-mannosidosis (ISO)

Cocaine-Related Disorders (ISO)

Delayed Puberty (ISO)

genetic disease (ISO)

hypertension (IDA)

hypogonadism (ISO)

hypogonadotropic hypogonadism (ISO)

hypogonadotropic hypogonadism 11 with or without anosmia (ISO,ISS)

hypogonadotropic hypogonadism 12 with or without anosmia (ISO)

hypogonadotropic hypogonadism 7 with or without anosmia (ISO)

Hypotension (IMP)

Inflammation (IEP)

Klinefelter syndrome (ISO)

Pain (IMP)

visual epilepsy (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

3,4-methylenedioxymethamphetamine (EXP)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

alcohol (ISO)

ammonium chloride (EXP)

aripiprazole (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP)

CGP 52608 (ISO)

chlorpyrifos (EXP,ISO)

cocaine (ISO)

daidzein (ISO)

dibutyl phthalate (EXP)

epoxiconazole (ISO)

ethanol (ISO)

flavonoids (EXP)

folic acid (ISO)

genistein (EXP,ISO)

glycitein (ISO)

hydrogen chloride (EXP)

imidacloprid (EXP)

lead diacetate (EXP)

methoxychlor (EXP)

methylmercury chloride (ISO)

paracetamol (ISO)

propanal (ISO)

sodium arsenite (ISO)

triptonide (ISO)

venlafaxine hydrochloride (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of blood pressure (IDA)

positive regulation of flagellated sperm motility (IBA,ISO)

positive regulation of heart rate (IDA)

positive regulation of uterine smooth muscle contraction (IDA)

regulation of dopamine metabolic process (IDA)

regulation of feeding behavior (IDA)

response to cocaine (IMP)

response to estradiol (IDA,IEP)

tachykinin receptor signaling pathway (IEA)

Cellular Component

dendrite membrane (IDA)

neuronal cell body membrane (IDA)

plasma membrane (IBA)

sperm midpiece (IBA,ISO)

Molecular Function

protein binding (ISO)

tachykinin receptor activity (IBA,IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Neurokinin-3 receptors modulate dopamine cell function and alter the effects of 6-hydroxydopamine.	Bannon MJ, etal., Brain Res. 1995 Oct 9;695(1):19-24.
2.	Evidence for mediation of nociception by injection of the NK-3 receptor agonist, senktide, into the dorsal periaqueductal gray of rats.	Bassi GS, etal., Psychopharmacology (Berl). 2008 Dec 18.
3.	Estrogen-dependent regulation of neurokinin 3 receptor-mediated uterine contractility in the rat.	Crane LH, etal., Biol Reprod. 2002 Nov;67(5):1480-7.
4.	Localization of the neuromedin K receptor (NK3) in the central nervous system of the rat.	Ding YQ, etal., J Comp Neurol. 1996 Jan 8;364(2):290-310.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Agonist and hypertonic saline-induced trafficking of the NK3-receptors on vasopressin neurons within the paraventricular nucleus of the hypothalamus.	Haley GE and Flynn FW, Am J Physiol Regul Integr Comp Physiol. 2006 May;290(5):R1242-50. Epub 2005 Dec 15.
8.	Blockade of NK3R signaling in the PVN decreases vasopressin and oxytocin release and c-Fos expression in the magnocellular neurons in response to hypotension.	Haley GE and Flynn FW, Am J Physiol Regul Integr Comp Physiol. 2008 Oct;295(4):R1158-67. Epub 2008 Jul 23.
9.	Characterization of ligand-binding properties and selectivities of three rat tachykinin receptors by transfection and functional expression of their cloned cDNAs in mammalian cells.	Ingi T, etal., J Pharmacol Exp Ther. 1991 Dec;259(3):968-75.
10.	Trafficking of tachykinin neurokinin 3 receptor to nuclei of neurons in the paraventricular nucleus of the hypothalamus following osmotic challenge.	Jensen D, etal., Neuroscience. 2008 Jul 31;155(1):308-16. Epub 2008 May 24.
11.	Neurokinin 3 receptor activation potentiates the psychomotor and nucleus accumbens dopamine response to cocaine, but not its place conditioning effects.	Jocham G, etal., Eur J Neurosci. 2007 Apr;25(8):2457-72.
12.	Time-dependent changes in neurokinin(3) receptors and tachykinins during adjuvant-induced peripheral inflammation in the rat.	Linden DR, etal., Neuroscience. 2000;98(4):801-11.
13.	The tachykinin NH2-senktide, a selective neurokinin B receptor agonist, is a very potent inhibitor of salt appetite in the rat.	Massi M, etal., Neurosci Lett. 1988 Oct 17;92(3):341-6.
14.	The formalin-induced expression of tachykinin peptide and neurokinin receptor messenger RNAs in rat sensory ganglia and spinal cord is modulated by opiate preadministration.	McCarson KE and Krause JE, Neuroscience. 1995 Feb;64(3):729-39.
15.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
16.	Age and species-dependent differences in the neurokinin B system in rat and human brain.	Mileusnic D, etal., Neurobiol Aging. 1999 Jan-Feb;20(1):19-35.
17.	Cardiovascular roles of tachykinin peptides in the nucleus tractus solitarii of rats.	Nagashima A, etal., Brain Res. 1989 May 22;487(2):392-6.
18.	Central pressor actions of neurokinin B: increases in neurokinin B contents in discrete nuclei in spontaneously hypertensive rats.	Nagashima A, etal., Brain Res. 1989 Oct 9;499(1):198-203.
19.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
20.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
21.	Tachykinin receptor and neutral endopeptidase gene expression in the rat uterus: characterization and regulation in response to ovarian steroid treatment.	Pinto FM, etal., Endocrinology. 1999 Jun;140(6):2526-32.
22.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
23.	GOA pipeline	RGD automated data pipeline
24.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
26.	Kainic acid induced seizures cause a marked increase in the expression of neurokinin-3 receptor mRNA in the rat cerebellum.	Roder C, etal., Neurosci Lett. 1994 Nov 7;181(1-2):158-60.
27.	The third intracellular loop and carboxyl tail of neurokinin 1 and 3 receptors determine interactions with beta-arrestins.	Schmidlin F, etal., Am J Physiol Cell Physiol 2003 Oct;285(4):C945-58.
28.	Cloning and expression of a rat neuromedin K receptor cDNA.	Shigemoto R, etal., J Biol Chem 1990 Jan 15;265(2):623-8.

Additional References at PubMed

PMID:15121234	PMID:15537880	PMID:16025449	PMID:17197098	PMID:17437961	PMID:17522129	PMID:19224600	PMID:20709160	PMID:21045176	PMID:21166923	PMID:21697521	PMID:21939739
PMID:22762252	PMID:22985858	PMID:23150555	PMID:23983264	PMID:24708241	PMID:24863620	PMID:25825817	PMID:26851555	PMID:30207304

Genomics

Comparative Map Data

Tacr3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	223,266,536 - 223,363,791 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	223,266,536 - 223,363,791 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	230,969,011 - 231,055,530 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	228,868,726 - 228,955,238 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	223,733,543 - 223,820,045 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	240,021,152 - 240,118,971 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	240,021,152 - 240,118,971 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	258,547,661 - 258,644,112 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	232,309,015 - 232,404,964 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	232,295,754 - 232,391,704 (+)	NCBI
Celera	2	215,485,216 - 215,569,645 (+)	NCBI		Celera
Cytogenetic Map	2	q43	NCBI

TACR3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	103,586,031 - 103,719,985 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	103,586,031 - 103,719,985 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	104,507,188 - 104,641,142 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	104,730,074 - 104,860,422 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	104,868,228 - 104,998,577	NCBI
Celera	4	101,809,125 - 101,939,478 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI
HuRef	4	100,245,509 - 100,375,866 (-)	NCBI		HuRef
CHM1_1	4	104,487,252 - 104,617,580 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	106,897,954 - 107,031,922 (-)	NCBI		T2T-CHM13v2.0

Tacr3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	134,534,768 - 134,640,342 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	134,534,768 - 134,640,340 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	134,829,007 - 134,934,581 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	134,829,007 - 134,934,579 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	134,491,971 - 134,597,545 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	134,766,394 - 134,871,959 (+)	NCBI		MGSCv36	mm8
Celera	3	141,238,671 - 141,345,575 (+)	NCBI		Celera
Cytogenetic Map	3	G3	NCBI
cM Map	3	62.47	NCBI

Tacr3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955496	5,151,668 - 5,222,624 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955496	5,152,134 - 5,222,565 (+)	NCBI	ChiLan1.0	ChiLan1.0

TACR3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	4	101,936,181 - 102,074,800 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	96,022,788 - 96,162,249 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	106,644,943 - 106,776,172 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	106,644,943 - 106,776,172 (-)	Ensembl	panpan1.1		panPan2

TACR3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	24,812,344 - 24,888,452 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	24,812,119 - 24,907,580 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	17,136,602 - 17,213,041 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	25,029,113 - 25,105,792 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	25,028,888 - 25,106,462 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	25,048,235 - 25,126,781 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	24,791,973 - 24,868,622 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	14,994,194 - 15,070,872 (+)	NCBI		UU_Cfam_GSD_1.0

TACR3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	117,662,122 - 117,721,613 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	117,662,122 - 117,718,317 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	126,511,759 - 126,570,636 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TACR3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	51,662,248 - 51,764,058 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	51,665,147 - 51,762,390 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	30,211,968 - 30,313,605 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tacr3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624830	4,635,987 - 4,704,251 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tacr3
723 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	52
Count of miRNA genes:	48
Interacting mature miRNAs:	51
Transcripts:	ENSRNOT00000012473
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	199341726	234244620	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	202446871	237938339	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	211744537	249053267	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	211744537	249053267	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	211744537	249053267	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	211744537	249053267	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	211744537	249053267	Rat
2317885	Alcrsp28	Alcohol response QTL 28	2.1	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	212828222	249053267	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	214226044	247136170	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	215377404	237938339	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	218414747	240841241	Rat
1359019	Hrtrt19	Heart rate QTL 19	2.9		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	219753301	226277316	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat

Markers in Region

D2Rat64

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	223,265,204 - 223,265,385 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	240,019,821 - 240,020,001	NCBI	Rnor6.0
Rnor_5.0	2	258,546,330 - 258,546,510	UniSTS	Rnor5.0
RGSC_v3.4	2	232,307,684 - 232,307,864	UniSTS	RGSC3.4
RGSC_v3.4	2	232,307,683 - 232,307,864	RGD	RGSC3.4
RGSC_v3.1	2	232,294,423 - 232,294,604	RGD
Celera	2	215,483,885 - 215,484,065	UniSTS
RH 3.4 Map	2	1547.0	RGD
RH 3.4 Map	2	1547.0	UniSTS
RH 2.0 Map	2	1118.5	RGD
SHRSP x BN Map	2	95.4298	RGD
FHH x ACI Map	2	110.7298	RGD
Cytogenetic Map	2	q42-q44	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									5
Low	1	1	2	2		2			59	31	26	4
Below cutoff	2	37	34	19	16	19	8	8	8	4	8	5	8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J05189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000012473 ⟹ ENSRNOP00000012473

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	223,266,536 - 223,363,791 (+)	Ensembl
Rnor_6.0 Ensembl	2	240,021,152 - 240,118,971 (+)	Ensembl

RefSeq Acc Id:

NM_017053 ⟹ NP_058749

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	223,266,536 - 223,363,791 (+)	NCBI
Rnor_6.0	2	240,021,152 - 240,118,971 (+)	NCBI
Rnor_5.0	2	258,547,661 - 258,644,112 (+)	NCBI
RGSC_v3.4	2	232,309,015 - 232,404,964 (+)	RGD
Celera	2	215,485,216 - 215,569,645 (+)	RGD

Sequence:

show sequence

ATCTCTGGTTCTCTCCTGCCCAGAAGAGCAGCAAACTACCAGGAGTAAGTGAGGCTCCAGCTCC
GTCGCCTTTGCCCCAATCACAGCATCCCAGGGGGCGGTACCATCACTGCCGGCTACCAGGTAGT
ACCCCAAAACAACGTGCCTAAGGGGTGAAGAACTTCAAGGGAGCTGGCTCCTGCTAGCCGCCCG
GAGTGTGGCAGGTCCCAGGCTGCAGACGCTGGCCATGGCCTCAGTCCCCAGGGGCGAAAACTGG
ACCGACGGGACGGTGGAAGTGGGGACCCATACAGGGAATCTGAGCTCCGCGCTGGGGGTCACTG
AGTGGCTTGCGCTCCAAGCTGGCAACTTCTCTTCAGCGCTGGGGTTGCCGGCGACAACCCAGGC
ACCTTCCCAGGTCCGGGCTAACCTGACCAACCAGTTCGTGCAGCCGTCCTGGCGGATCGCGCTC
TGGTCCCTGGCCTATGGCTTGGTGGTGGCCGTGGCAGTCTTCGGAAACCTCATCGTTATCTGGA
TCATCCTAGCCCACAAGCGCATGAGAACTGTCACCAACTATTTCCTGGTAAACCTGGCTTTCTC
CGACGCCTCCGTGGCTGCCTTCAACACCTTGATCAATTTCATCTATGGTCTTCACAGCGAGTGG
TACTTTGGCGCCAACTACTGCCGCTTCCAGAACTTCTTTCCCATCACAGCGGTGTTTGCCAGCA
TCTACTCTATGACAGCCATTGCAGTGGACAGGTATATGGCTATTATTGATCCGTTGAAACCCAG
ACTTTCTGCCACAGCCACTAAGATTGTCATTGGAAGTATTTGGATTTTGGCATTTCTACTTGCC
TTCCCTCAATGCCTTTATTCCAAAATAAAAGTCATGCCGGGCCGTACTCTTTGCTACGTGCAGT
GGCCAGAAGGTCCCAAGCAACATTTCACGTACCACATCATTGTGATCATCCTGGTGTACTGTTT
CCCACTGCTCATCATGGGTGTCACCTACACCATCGTTGGAATTACTCTCTGGGGAGGAGAGATC
CCAGGAGACACCTGTGACAAGTACCATGAGCAGCTGAAGGCTAAACGAAAGGTGGTAAAGATGA
TGATCATTGTGGTGGTGACGTTTGCCATCTGCTGGCTGCCCTATCACGTGTATTTCATTCTCAC
TGCGATCTACCAACAGTTAAACAGATGGAAATACATTCAACAGGTCTACCTGGCTAGCTTCTGG
CTGGCAATGAGCTCGACCATGTACAACCCCATCATCTACTGCTGTTTGAACAAAAGATTCCGCG
CAGGCTTCAAGAGAGCATTTCGCTGGTGTCCTTTCATCCAAGTCTCCAGCTACGATGAGCTGGA
GCTCAAGACCACCAGGTTTCATCCCACACGACAGAGCAGCCTGTACACCGTGAGCAGGATGGAG
TCGGTGACCGTGCTGTTTGACCCCAATGATGGAGACCCAACCAAATCCAGCCGCAAGAAGAGGG
CGGTGCCCAGAGACCCCAGTGCCAATGGCTGTTCCCACAGAGGTTCCAAATCTGCCTCCACCAC
ATCAAGTTTCATAAGCTCACCCTATACCTCTGTGGATGAATATTCCTAAGTCCATGTCCCAAGG
TGATAGCTATCATGAGGCCACCGTGAGGCCAGCCTAGGTCCCTCATTCTCCTAACCATGCCAGA
TCCTGTTCTAGGTACTTTGGGGAAGCAGAAGGGCAGTTCTTAGGTGGGCATACTTAATCTGAGA
AAAGTGGAATACCAATGTAACGAAAACTACCAACATGTCAGCCAGCACAGAGAAAACTGAGTCT
TTAATTTATTCTTTAAGATTCTTAAGGGTCATATGCAGCAGGTACAAAGTGTGAGTCTGAAAAA
TGACCTAAGTGTCCACTGTCCGCCATTTAACAACGGCAGTGCACCTTTGTGACCGCAGAAGAGC
AGAGGGGTTTTCCAAGAGATTAAGGAAGCTCTAAATTGCAAATCTGACCAAGGGAAACATGACC
TACATAAAACAGAAATTCTCTGTGGCTATGAAGTAGAAAGGGCAAATGACTGACTTCCCACACA
CAAGTAATAAAAAAATAACCTCAAAGAGTAGGAAAATATGAAAGCCTTTTCTCATTCAAAATTC
ATTTTGTAGAATGAAAATTTTCAGAAATTCCCTCTAATACATTTTGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_058749	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41688	(Get FASTA)	NCBI Sequence Viewer
	EDL82245	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012473
GenBank Protein	P16177	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058749 ⟸ NM_017053

- UniProtKB:

P16177 (UniProtKB/Swiss-Prot), A6HVV9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASVPRGENWTDGTVEVGTHTGNLSSALGVTEWLALQAGNFSSALGLPATTQAPSQVRANLTNQ
FVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASVAAFNTLI
NFIYGLHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIG
SIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVIILVYCFPLLIMGVTYTI
VGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVVTFAICWLPYHVYFILTAIYQQLNRWKY
IQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRWCPFIQVSSYDELELKTTRFHPTRQ
SSLYTVSRMESVTVLFDPNDGDPTKSSRKKRAVPRDPSANGCSHRGSKSASTTSSFISSPYTSV
DEYS

hide sequence

RefSeq Acc Id:

ENSRNOP00000012473 ⟸ ENSRNOT00000012473

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P16177-F1-model_v2	AlphaFold	P16177	1-452	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3810	AgrOrtholog
BioCyc Gene	G2FUF-51147	BioCyc
Ensembl Genes	ENSRNOG00000009372	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000012473	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Neurokn_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NK3_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24808	UniProtKB/Swiss-Prot
NCBI Gene	24808	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR TKR-1-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROMEDIN-K RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tacr3	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROKININ3R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROKININR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009372	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6HVV9	ENTREZGENE, UniProtKB/TrEMBL
	NK3R_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Name	Description	Reference	Status
2004-09-10	Tacr3	tachykinin receptor 3	tachikin receptor 3	Name updated	1299863	APPROVED
2002-06-10	Tacr3	tachikin receptor 3		Symbol and Name status set to approved	70586	APPROVED
2000-11-11	Tac3r	Neuromedin K receptor (Neurokinin B/Tachikin 3)		Symbol and name withdrawn	61478	WITHDRAWN
2000-11-11	Tacr3	Tachikin receptor 3		Symbol and name updated	61478	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in brain and peripheral tissues	68907
gene_product	member of the seven transmembrane domain superfamily of G protein coupled receptors	68907
gene_protein	predicted protein consists of 452 aa residues	68907

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)