Symbol:
Ibsp
Name:
integrin binding sialoprotein
RGD ID:
10755
MGI Page
MGI
Description:
Predicted to enable integrin binding activity and small molecule binding activity. Acts upstream of or within bone mineralization; cellular response to growth factor stimulus; and extracellular matrix organization. Predicted to be located in extracellular space and vesicle. Is expressed in several structures, including facial prominence; jaw; limb; perichondrium; and skeleton. Orthologous to human IBSP (integrin binding sialoprotein).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
B; bone sialoprotein 2; bone sialoprotein II; Bs; BSP; BSP II; Bsp2; BSPII; cell-binding sialoprotein; integrin-binding sialoprotein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IBSP (integrin binding sialoprotein) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Ibsp (integrin-binding sialoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ibsp (integrin binding sialoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
IBSP (integrin binding sialoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IBSP (integrin binding sialoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ibsp (integrin binding sialoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
IBSP (integrin binding sialoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IBSP (integrin binding sialoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ibsp (integrin binding sialoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ibsp (integrin-binding sialoprotein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
IBSP (integrin binding sialoprotein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ibsp
Alliance
DIOPT (InParanoid|OMA)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 104,447,153 - 104,459,338 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 104,447,037 - 104,459,335 (+) Ensembl GRCm39 Ensembl GRCm38 5 104,299,287 - 104,311,472 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 104,299,171 - 104,311,469 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 104,728,306 - 104,740,491 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 104,539,600 - 104,551,767 (+) NCBI MGSCv36 mm8 Celera 5 101,608,398 - 101,620,486 (+) NCBI Celera Cytogenetic Map 5 E5 NCBI cM Map 5 50.68 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ibsp Mouse (S)-nicotine decreases expression ISO Ibsp (Rattus norvegicus) 6480464 Nicotine results in decreased expression of IBSP mRNA CTD PMID:29981921 Ibsp Mouse 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine increases expression ISO Ibsp (Rattus norvegicus) 6480464 chlorcyclizine results in increased expression of IBSP mRNA CTD PMID:21058326 Ibsp Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of IBSP mRNA CTD PMID:12469912 Ibsp Mouse 17beta-estradiol multiple interactions ISO IBSP (Homo sapiens) 6480464 [Estradiol co-treated with ESR1 protein] results in increased expression of BSP mRNA and [Estradiol co-treated with ESR2 protein] results in increased expression of BSP mRNA CTD PMID:19347870 Ibsp Mouse 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one multiple interactions ISO IBSP (Homo sapiens) 6480464 1H-(1 more ... CTD PMID:22543296 Ibsp Mouse 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one decreases expression ISO IBSP (Homo sapiens) 6480464 1H-(1 more ... CTD PMID:22543296 Ibsp Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IBSP mRNA CTD PMID:28836330 Ibsp Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO IBSP (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of IBSP mRNA CTD PMID:30203000 and PMID:31887333 Ibsp Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 actein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of IBSP mRNA] CTD PMID:28836330 Ibsp Mouse 6-propyl-2-thiouracil decreases expression ISO Ibsp (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of IBSP mRNA CTD PMID:24780913 Ibsp Mouse 6-propyl-2-thiouracil multiple interactions EXP 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in increased expression of IBSP mRNA CTD PMID:36706583 Ibsp Mouse Actein multiple interactions EXP 6480464 actein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of IBSP mRNA] CTD PMID:28836330 Ibsp Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [Tretinoin co-treated with Cholecalciferol] results in increased expression of IBSP CTD PMID:17170073 Ibsp Mouse all-trans-retinoic acid decreases expression ISO IBSP (Homo sapiens) 6480464 Tretinoin results in decreased expression of IBSP mRNA CTD PMID:33167477 Ibsp Mouse aluminium oxide increases expression ISO IBSP (Homo sapiens) 6480464 Aluminum Oxide results in increased expression of IBSP mRNA CTD PMID:19464052 Ibsp Mouse amitrole decreases expression ISO Ibsp (Rattus norvegicus) 6480464 Amitrole results in decreased expression of IBSP mRNA CTD PMID:38685447 Ibsp Mouse ammonium chloride affects expression ISO Ibsp (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of IBSP mRNA CTD PMID:16483693 Ibsp Mouse anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO IBSP (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [Ketoglutaric Acids results in increased expression of IBSP protein] CTD PMID:31051157 Ibsp Mouse anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions EXP 6480464 pyrazolanthrone inhibits the reaction [Ketoglutaric Acids results in increased expression of IBSP protein] CTD PMID:31051157 Ibsp Mouse benzo[a]pyrene affects methylation ISO IBSP (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of IBSP promoter CTD PMID:27901495 Ibsp Mouse bisphenol A decreases expression ISO Ibsp (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of IBSP mRNA CTD PMID:25181051 Ibsp Mouse bisphenol A increases expression ISO Ibsp (Rattus norvegicus) 6480464 bisphenol A results in increased expression of IBSP mRNA CTD PMID:30816183 and PMID:32528016 Ibsp Mouse cadmium atom increases expression ISO IBSP (Homo sapiens) 6480464 Cadmium results in increased expression of IBSP mRNA CTD PMID:20570719 Ibsp Mouse cadmium atom decreases expression ISO IBSP (Homo sapiens) 6480464 Cadmium results in decreased expression of IBSP mRNA CTD PMID:20570719 Ibsp Mouse caffeine decreases expression ISO Ibsp (Rattus norvegicus) 6480464 Caffeine results in decreased expression of IBSP mRNA CTD PMID:31874197 Ibsp Mouse calcidiol multiple interactions ISO IBSP (Homo sapiens) 6480464 CYP27B1 protein promotes the reaction [Calcifediol results in increased expression of IBSP mRNA] and Ketoconazole inhibits the reaction [Calcifediol results in increased expression of IBSP mRNA] CTD PMID:21542014 Ibsp Mouse calcidiol increases expression ISO IBSP (Homo sapiens) 6480464 Calcifediol results in increased expression of IBSP mRNA CTD PMID:21542014 Ibsp Mouse calciol multiple interactions EXP 6480464 [Tretinoin co-treated with Cholecalciferol] results in increased expression of IBSP CTD PMID:17170073 Ibsp Mouse calcitriol increases expression ISO IBSP (Homo sapiens) 6480464 Calcitriol results in increased expression of IBSP mRNA CTD PMID:21542014 and PMID:28105418 Ibsp Mouse camptothecin decreases response to substance ISO IBSP (Homo sapiens) 6480464 IBSP mRNA results in decreased susceptibility to Camptothecin CTD PMID:25269479 Ibsp Mouse chlorpromazine decreases expression ISO Ibsp (Rattus norvegicus) 6480464 Chlorpromazine results in decreased expression of IBSP mRNA CTD PMID:16294319 Ibsp Mouse chlorpromazine multiple interactions ISO Ibsp (Rattus norvegicus) 6480464 herbimycin inhibits the reaction [Chlorpromazine results in decreased expression of IBSP mRNA] and U 0126 inhibits the reaction [Chlorpromazine results in decreased expression of IBSP mRNA] CTD PMID:16294319 Ibsp Mouse cisplatin decreases expression ISO Ibsp (Rattus norvegicus) 6480464 Cisplatin results in decreased expression of IBSP mRNA CTD PMID:22023808 Ibsp Mouse cobalt dichloride multiple interactions ISO IBSP (Homo sapiens) 6480464 cobaltous chloride affects the reaction [BMP2 protein results in increased expression of IBSP mRNA] CTD PMID:26054564 Ibsp Mouse cobalt dichloride increases expression ISO Ibsp (Rattus norvegicus) 6480464 cobaltous chloride results in increased expression of IBSP mRNA CTD PMID:26054564 Ibsp Mouse daidzein multiple interactions ISO IBSP (Homo sapiens) 6480464 [daidzein co-treated with ESR1 protein] results in increased expression of BSP mRNA and [daidzein co-treated with ESR2 protein] results in increased expression of BSP mRNA CTD PMID:19347870 Ibsp Mouse DDT increases methylation ISO Ibsp (Rattus norvegicus) 6480464 DDT results in increased methylation of IBSP gene CTD PMID:30207508 Ibsp Mouse decabromodiphenyl ether decreases expression ISO Ibsp (Rattus norvegicus) 6480464 decabromobiphenyl ether results in decreased expression of IBSP mRNA CTD PMID:23914054 Ibsp Mouse dexamethasone multiple interactions EXP 6480464 [Ascorbic Acid co-treated with Dexamethasone co-treated with beta-glycerophosphoric acid] results in increased expression of IBSP mRNA more ... CTD PMID:26492236 Ibsp Mouse dexamethasone multiple interactions ISO Ibsp (Rattus norvegicus) 6480464 [beta-glycerophosphoric acid co-treated with Ascorbic Acid co-treated with Dexamethasone] affects the expression of IBSP mRNA more ... CTD PMID:27028516 Ibsp Mouse diiodine multiple interactions EXP 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in increased expression of IBSP mRNA CTD PMID:36706583 Ibsp Mouse ethanol increases expression ISO Ibsp (Rattus norvegicus) 6480464 Ethanol results in increased expression of IBSP mRNA CTD PMID:31078653 Ibsp Mouse ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of IBSP mRNA CTD PMID:34755883 Ibsp Mouse eugenol decreases expression ISO IBSP (Homo sapiens) 6480464 Eugenol results in decreased expression of IBSP mRNA and Eugenol results in decreased expression of IBSP protein CTD PMID:21706355 Ibsp Mouse flavonoids increases expression ISO Ibsp (Rattus norvegicus) 6480464 Flavonoids results in increased expression of IBSP mRNA CTD PMID:18035473 Ibsp Mouse furan increases methylation ISO Ibsp (Rattus norvegicus) 6480464 furan results in increased methylation of IBSP gene CTD PMID:22079235 Ibsp Mouse genistein multiple interactions ISO IBSP (Homo sapiens) 6480464 [Genistein co-treated with ESR1] results in increased expression of BSP mRNA and [Genistein co-treated with ESR2] results in increased expression of BSP mRNA CTD PMID:19347870 Ibsp Mouse geranylgeraniol multiple interactions ISO IBSP (Homo sapiens) 6480464 geranylgeraniol inhibits the reaction [zoledronic acid results in increased expression of IBSP mRNA] CTD PMID:15324309 Ibsp Mouse glycerol 2-phosphate multiple interactions ISO Ibsp (Rattus norvegicus) 6480464 [beta-glycerophosphoric acid co-treated with Ascorbic Acid co-treated with Dexamethasone] affects the expression of IBSP mRNA more ... CTD PMID:27028516 Ibsp Mouse glycerol 2-phosphate multiple interactions EXP 6480464 [Ascorbic Acid co-treated with Dexamethasone co-treated with beta-glycerophosphoric acid] results in increased expression of IBSP mRNA more ... CTD PMID:26492236 Ibsp Mouse herbimycin multiple interactions ISO Ibsp (Rattus norvegicus) 6480464 herbimycin inhibits the reaction [Chlorpromazine results in decreased expression of IBSP mRNA] CTD PMID:16294319 Ibsp Mouse hydrogen peroxide multiple interactions ISO Ibsp (Rattus norvegicus) 6480464 Hydrogen Peroxide affects the reaction [[beta-glycerophosphoric acid co-treated with Ascorbic Acid co-treated with Dexamethasone] affects the expression of IBSP mRNA] and Quercetin affects the reaction [Hydrogen Peroxide affects the reaction [[beta-glycerophosphoric acid co-treated with Ascorbic Acid co-treated with Dexamethasone] affects the expression of IBSP mRNA]] CTD PMID:27028516 Ibsp Mouse ketoconazole multiple interactions ISO IBSP (Homo sapiens) 6480464 Ketoconazole inhibits the reaction [Calcifediol results in increased expression of IBSP mRNA] CTD PMID:21542014 Ibsp Mouse L-ascorbic acid increases expression ISO IBSP (Homo sapiens) 6480464 Ascorbic Acid results in increased expression of IBSP mRNA CTD PMID:28105418 Ibsp Mouse L-ascorbic acid multiple interactions EXP 6480464 [Ascorbic Acid co-treated with Dexamethasone co-treated with beta-glycerophosphoric acid] results in increased expression of IBSP mRNA more ... CTD PMID:26492236 Ibsp Mouse L-ascorbic acid multiple interactions ISO Ibsp (Rattus norvegicus) 6480464 [beta-glycerophosphoric acid co-treated with Ascorbic Acid co-treated with Dexamethasone] affects the expression of IBSP mRNA more ... CTD PMID:27028516 Ibsp Mouse lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of IBSP mRNA CTD PMID:22609695 Ibsp Mouse lipopolysaccharide multiple interactions ISO IBSP (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Ibsp Mouse lithium chloride decreases expression EXP 6480464 Lithium Chloride results in decreased expression of IBSP mRNA CTD PMID:19442631 Ibsp Mouse magnesium atom increases expression ISO IBSP (Homo sapiens) 6480464 Magnesium results in increased expression of IBSP protein CTD PMID:10397942 Ibsp Mouse methimazole decreases expression ISO Ibsp (Rattus norvegicus) 6480464 Methimazole results in decreased expression of IBSP mRNA CTD PMID:38685447 Ibsp Mouse nickel atom affects expression ISO IBSP (Homo sapiens) 6480464 Nickel affects the expression of IBSP mRNA CTD PMID:14575637 Ibsp Mouse nickel atom multiple interactions ISO IBSP (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of IBSP mRNA] CTD PMID:14575637 Ibsp Mouse nicotine decreases expression ISO Ibsp (Rattus norvegicus) 6480464 Nicotine results in decreased expression of IBSP mRNA CTD PMID:29981921 Ibsp Mouse nitroprusside multiple interactions ISO IBSP (Homo sapiens) 6480464 1H-(1 more ... CTD PMID:22543296 Ibsp Mouse nitroprusside increases expression ISO IBSP (Homo sapiens) 6480464 Nitroprusside results in increased expression of IBSP mRNA CTD PMID:22543296 Ibsp Mouse oxaliplatin multiple interactions ISO Ibsp (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of IBSP mRNA CTD PMID:25729387 Ibsp Mouse oxaliplatin increases expression ISO Ibsp (Rattus norvegicus) 6480464 oxaliplatin results in increased expression of IBSP mRNA CTD PMID:25729387 Ibsp Mouse paraquat increases expression ISO Ibsp (Rattus norvegicus) 6480464 Paraquat results in increased expression of IBSP mRNA CTD PMID:32680482 Ibsp Mouse phorbol 13-acetate 12-myristate multiple interactions ISO IBSP (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of IBSP mRNA CTD PMID:16979875 Ibsp Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of IBSP mRNA CTD PMID:17950772 Ibsp Mouse quercetin increases expression ISO Ibsp (Rattus norvegicus) 6480464 Quercetin metabolite results in increased expression of IBSP mRNA and Quercetin results in increased expression of IBSP mRNA CTD PMID:17243115 and PMID:26053266 Ibsp Mouse quercetin multiple interactions ISO Ibsp (Rattus norvegicus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Quercetin results in increased expression of IBSP mRNA] more ... CTD PMID:26053266 and PMID:27028516 Ibsp Mouse quercetin 3-O-beta-D-glucofuranoside increases expression ISO Ibsp (Rattus norvegicus) 6480464 isoquercitrin results in increased expression of IBSP mRNA CTD PMID:30365939 Ibsp Mouse quercetin 3-O-beta-D-glucopyranoside increases expression ISO Ibsp (Rattus norvegicus) 6480464 isoquercitrin results in increased expression of IBSP mRNA CTD PMID:30365939 Ibsp Mouse S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO IBSP (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of IBSP mRNA CTD PMID:35811015 Ibsp Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO IBSP (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Ibsp Mouse simvastatin increases expression EXP 6480464 Simvastatin results in increased expression of IBSP mRNA CTD PMID:20417880 Ibsp Mouse sirolimus multiple interactions ISO IBSP (Homo sapiens) 6480464 Sirolimus inhibits the reaction [Ketoglutaric Acids results in increased expression of IBSP protein] CTD PMID:31051157 Ibsp Mouse sirolimus multiple interactions EXP 6480464 Sirolimus inhibits the reaction [Ketoglutaric Acids results in increased expression of IBSP protein] CTD PMID:31051157 Ibsp Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of IBSP mRNA CTD PMID:37682722 Ibsp Mouse sodium chloride increases expression ISO Ibsp (Rattus norvegicus) 6480464 Sodium Chloride results in increased expression of IBSP mRNA CTD PMID:37992803 Ibsp Mouse spermine increases expression EXP 6480464 Spermine results in increased expression of IBSP mRNA CTD PMID:18673383 Ibsp Mouse tacrine increases expression ISO Ibsp (Rattus norvegicus) 6480464 Tacrine results in increased expression of IBSP mRNA CTD PMID:12832660 Ibsp Mouse tamoxifen multiple interactions ISO IBSP (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR1 protein] results in increased expression of BSP mRNA CTD PMID:19347870 Ibsp Mouse telmisartan increases expression ISO Ibsp (Rattus norvegicus) 329956421 telmisartan increases expression of mRNA in mandible of WKY rats with periodontal disease RGD Ibsp Mouse titanium dioxide increases expression ISO IBSP (Homo sapiens) 6480464 titanium dioxide results in increased expression of IBSP mRNA CTD PMID:19464052 Ibsp Mouse topotecan multiple interactions ISO Ibsp (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of IBSP mRNA CTD PMID:25729387 Ibsp Mouse Tributyltin oxide increases expression EXP 6480464 bis(tri-n-butyltin)oxide results in increased expression of IBSP mRNA CTD PMID:18958704 Ibsp Mouse trichloroethene decreases expression ISO Ibsp (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of IBSP mRNA CTD PMID:33387578 Ibsp Mouse trichostatin A multiple interactions ISO IBSP (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of IBSP mRNA] CTD PMID:14575637 Ibsp Mouse zinc atom multiple interactions ISO IBSP (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of IBSP mRNA CTD PMID:16979875 Ibsp Mouse zinc(0) multiple interactions ISO IBSP (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of IBSP mRNA CTD PMID:16979875 Ibsp Mouse zoledronic acid multiple interactions ISO IBSP (Homo sapiens) 6480464 [zoledronic acid results in decreased geranoylation of RHOA protein] which results in increased expression of IBSP mRNA more ... CTD PMID:15324309 Ibsp Mouse zoledronic acid increases expression ISO IBSP (Homo sapiens) 6480464 zoledronic acid results in increased expression of IBSP protein CTD PMID:15324309
Imported Annotations - KEGG (archival)
(S)-nicotine (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (ISO) 17beta-estradiol (EXP,ISO) 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 6-propyl-2-thiouracil (EXP,ISO) Actein (EXP) all-trans-retinoic acid (EXP,ISO) aluminium oxide (ISO) amitrole (ISO) ammonium chloride (ISO) anthra[1,9-cd]pyrazol-6(2H)-one (EXP,ISO) benzo[a]pyrene (ISO) bisphenol A (ISO) cadmium atom (ISO) caffeine (ISO) calcidiol (ISO) calciol (EXP) calcitriol (ISO) camptothecin (ISO) chlorpromazine (ISO) cisplatin (ISO) cobalt dichloride (ISO) daidzein (ISO) DDT (ISO) decabromodiphenyl ether (ISO) dexamethasone (EXP,ISO) diiodine (EXP) ethanol (EXP,ISO) eugenol (ISO) flavonoids (ISO) furan (ISO) genistein (ISO) geranylgeraniol (ISO) glycerol 2-phosphate (EXP,ISO) herbimycin (ISO) hydrogen peroxide (ISO) ketoconazole (ISO) L-ascorbic acid (EXP,ISO) lead diacetate (EXP) lipopolysaccharide (ISO) lithium chloride (EXP) magnesium atom (ISO) methimazole (ISO) nickel atom (ISO) nicotine (ISO) nitroprusside (ISO) oxaliplatin (ISO) paraquat (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (EXP) quercetin (ISO) quercetin 3-O-beta-D-glucofuranoside (ISO) quercetin 3-O-beta-D-glucopyranoside (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) simvastatin (EXP) sirolimus (EXP,ISO) sodium arsenite (EXP) sodium chloride (ISO) spermine (EXP) tacrine (ISO) tamoxifen (ISO) telmisartan (ISO) titanium dioxide (ISO) topotecan (ISO) Tributyltin oxide (EXP) trichloroethene (ISO) trichostatin A (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
1.
Telmisartan Prevents Alveolar Bone Loss by Decreasing the Expression of Osteoclasts Markers in Hypertensive Rats With Periodontal Disease.
Brito VGB, etal., Front Pharmacol. 2020 Nov 11;11:579926. doi: 10.3389/fphar.2020.579926. eCollection 2020.
2.
Full-length sequence, localization, and chromosomal mapping of ameloblastin. A novel tooth-specific gene.
Krebsbach PH, etal., J Biol Chem 1996 Feb 23;271(8):4431-5.
3.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
The novel zinc finger-containing transcription factor osterix is required for osteoblast differentiation and bone formation.
Nakashima K, etal., Cell 2002 Jan 11;108(1):17-29.
6.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Ibsp Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 104,447,153 - 104,459,338 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 104,447,037 - 104,459,335 (+) Ensembl GRCm39 Ensembl GRCm38 5 104,299,287 - 104,311,472 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 104,299,171 - 104,311,469 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 104,728,306 - 104,740,491 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 104,539,600 - 104,551,767 (+) NCBI MGSCv36 mm8 Celera 5 101,608,398 - 101,620,486 (+) NCBI Celera Cytogenetic Map 5 E5 NCBI cM Map 5 50.68 NCBI
IBSP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 87,799,554 - 87,812,435 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 87,799,554 - 87,812,435 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 88,720,706 - 88,733,587 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 88,939,726 - 88,952,098 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 89,077,880 - 89,090,253 NCBI Celera 4 86,008,963 - 86,021,864 (+) NCBI Celera Cytogenetic Map 4 q22.1 NCBI HuRef 4 84,466,298 - 84,479,240 (+) NCBI HuRef CHM1_1 4 88,697,498 - 88,710,400 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 91,125,985 - 91,138,857 (+) NCBI T2T-CHM13v2.0
Ibsp Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 5,744,497 - 5,757,242 (-) NCBI GRCr8 mRatBN7.2 14 5,439,825 - 5,452,570 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 5,439,829 - 5,452,693 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx PNT010000191.1 7,456 - 18,326 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 6,702,628 - 6,715,531 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 5,392,008 - 5,404,941 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 6,801,200 - 6,813,987 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 6,801,204 - 6,813,945 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 6,789,269 - 6,807,502 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 6,548,541 - 6,561,165 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 6,548,544 - 6,561,169 (-) NCBI Celera 14 5,578,651 - 5,591,441 (-) NCBI Celera RH 3.4 Map 14 89.7 RGD Cytogenetic Map 14 p22 NCBI
Ibsp Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955474 2,074,659 - 2,086,289 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955474 2,074,659 - 2,086,289 (-) NCBI ChiLan1.0 ChiLan1.0
IBSP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 85,806,206 - 85,819,449 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 86,068,641 - 86,081,881 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 80,061,960 - 80,105,560 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 90,817,072 - 90,830,021 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 90,817,072 - 90,830,021 (+) Ensembl panpan1.1 panPan2
IBSP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 11,187,188 - 11,200,860 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 11,187,160 - 11,200,846 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 30,753,404 - 30,767,085 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 11,240,790 - 11,254,453 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 11,240,716 - 11,254,466 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 11,323,638 - 11,337,299 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 11,149,296 - 11,162,980 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 28,790,260 - 28,803,929 (-) NCBI UU_Cfam_GSD_1.0
Ibsp
IBSP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 131,208,282 - 131,241,266 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 131,208,281 - 131,222,048 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 140,438,439 - 140,452,241 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IBSP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 36,170,411 - 36,185,099 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 36,174,903 - 36,184,278 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 14,894,526 - 14,905,166 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ibsp
.
Predicted Target Of
Count of predictions: 258 Count of miRNA genes: 213 Interacting mature miRNAs: 233 Transcripts: ENSMUST00000031246 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10045978 Tir10_m trypanosome infection response 10 (mouse) Not determined 5 98019649 114021986 Mouse 1301399 Cpfd3_m cerebellum pattern fissures (mouse) Not determined 5 87386871 121387065 Mouse 25314310 Syncl4_m synaptonemal complex length 4 (mouse) 5 103047866 115538059 Mouse 1301524 Lmb2_m lupus in MRL and B6 F2 cross (mouse) Not determined 5 37581488 112465722 Mouse 25314315 Mlh1fc4_m MLH1 foci count 4 (mouse) 5 74460661 132528839 Mouse 1357725 Eae39_m experimental allergic encephalomyelitis 39 (mouse) Not determined 5 89418876 118864028 Mouse 14746986 Manh58_m mandible shape 58 (mouse) 5 102446283 136446283 Mouse 25314317 Sccor3_m synaptonemal complex length to mean MLH1 count ratio 3 (mouse) 5 104347866 114738061 Mouse 1300993 Hycdc_m hypercapnic duty cycle (mouse) Not determined 5 90561006 124561151 Mouse 1301126 Bwem1_m body weight day 30 males 1 (mouse) Not determined 5 87386871 121387065 Mouse 1300659 Pcd8ts1_m p-glycoprotein positive CD8 T cell subset 1 (mouse) Not determined 5 97021753 131021986 Mouse 1301042 Elmaz1_m elevated maze behavior 1 (mouse) Not determined 5 98019649 116876624 Mouse 1301691 Cdcs10_m cytokine deficiency colitis susceptibility 10 (mouse) Not determined 5 76280786 110280917 Mouse 10402486 Dipa1_m drug induced psychomotor activation 1 (mouse) Not determined 5 95465549 129465722 Mouse 11041665 Lmr24_m leishmaniasis resistance 24 (mouse) 5 52694462 107321041 Mouse 10043958 Chldq12_m cholesterol and HDL QTL 12 (mouse) Not determined 5 87386871 121387065 Mouse 26884395 Humsd2_m humerus midshaft diameter 2, 10 week (mouse) 5 70057343 132528839 Mouse 12904945 Tammq2_m tibialis anterior muscle mass QTL 2 (mouse) 5 100665965 134665965 Mouse 1301419 Cypr3_m cytokine production 3 (mouse) Not determined 5 81019649 115019803 Mouse 11341716 Rvfs3_m Rift Valley fever susceptibility 3 (mouse) 5 26441234 138455402 Mouse 12904959 Smmq1_m soleus muscle mass QTL 1 (mouse) 5 100665965 134665965 Mouse 13506928 Recrq8_m recombination rate in male meiosis QTL 8 (mouse) 5 74460661 132528839 Mouse 10043993 Hbnr10_m Heligmosomoides bakeri nematode resistance 10 (mouse) Not determined 5 72418876 106419011 Mouse 27226719 Tibw6_m tibia width 6, proximal, 16 week (mouse) 5 72857343 139985755 Mouse 10401246 Bglu13_m blood glucose level 13 (mouse) Not determined 5 79539640 113539786 Mouse 4141438 Skmw13_m skeletal muscle weight 13 (mouse) Not determined 5 76190263 110190479 Mouse 1301713 Dbsty2_m diabesity 2 (mouse) Not determined 5 76445064 110445225 Mouse 1301457 Cfsw2_m cystic fibrosis survival to weaning 2 (mouse) Not determined 5 90561006 124561151 Mouse 11041899 Lmr24a_m leishmaniasis resistance 24a (mouse) 5 52694462 107321041 Mouse 10401245 Bglu18_m blood glucose level 18 (mouse) Not determined 5 82838468 116838597 Mouse 1301974 Chab7_m cholesterol absorption 7 (mouse) Not determined 5 95233214 129233330 Mouse 11528550 Sluc33_m susceptibility to lung cancer 33 (mouse) 5 104386871 120711986 Mouse 4142064 Tmc1m4_m Tmc1 modifier 4 (mouse) Not determined 5 54500177 127001072 Mouse 1300931 Cocrb6_m cocaine related behavior 6 (mouse) Not determined 5 76445064 110445225 Mouse 4142317 Rgcs1_m retinal ganglion cell susceptible 1 (mouse) Not determined 55388334 108762627 Mouse 1300801 Drb2_m dopamine receptor binding 2 (mouse) Not determined 5 87386871 121387065 Mouse 1301829 Thyls2_m thymic lymphoma susceptibility 2 (mouse) Not determined 5 76445064 110445225 Mouse 9587780 Afw16_m abdominal fat weight QTL 16 (mouse) Not determined 5 92830166 126830285 Mouse 1357644 Egrd1_m early growth rate, direct effect 1 (mouse) Not determined 5 95434580 129434786 Mouse 12859290 Criq2_m Citrobacter rodentium infection QTL 2 (mouse) 5 101332579 135332579 Mouse 1300940 Actd3_m activity-distance traveled 3 (mouse) Not determined 5 96320385 130320533 Mouse 10755524 Mono1_m monocyte differential 1 (mouse) 5 80849259 114849259 Mouse 1301362 Prnr1_m prion resistance 1 (mouse) Not determined 5 89418876 146787935 Mouse 1558774 Lith17_m lithogenic gene 17 (mouse) Not determined 5 95465549 129465722 Mouse 1357431 Cia27_m collagen induced arthritis 27 (mouse) Not determined 5 75315348 120018629 Mouse 1301877 Bbaa3_m B.burgdorferi-associated arthritis 3 (mouse) Not determined 5 99455285 112465722 Mouse 1300986 Hdlq2_m HDL QTL 2 (mouse) Not determined 5 76280786 110280917 Mouse 1301624 Aevm2_m autoimmune extremity vasculitis in MRL mice 2 (mouse) Not determined 5 101863832 135864028 Mouse 11532736 Sluc33b_m susceptibility to lung cancer 33b (mouse) 5 102945037 136945196 Mouse 4141519 Hmtb5_m hemostasis and thrombosis bleeding time 5 (mouse) Not determined 99949422 126882944 Mouse 1301858 Smdq1_m segregation of mitochondrial DNA QTL 1 (mouse) Not determined 5 97021753 131021986 Mouse 11049562 Lmr24f_m leishmaniasis resistance 24f (mouse) 5 90320962 124321041 Mouse 13464249 Ahl16_m age related hearing loss, early onset 16 (mouse) 5 76445064 110445225 Mouse 13464244 Ahl19_m age related hearing loss, early onset 19 (mouse) 5 95465549 129465722 Mouse 1300968 Skts4_m skin tumor susceptibility 4 (mouse) Not determined 5 89418876 124238239 Mouse 13464241 Ahl18_m age related hearing loss, early onset 18 (mouse) 5 87386871 121387065 Mouse 4141505 Chlq14_m circulating hormone level QTL 14 (mouse) Not determined 5 76280786 110280917 Mouse 13464242 Ahl17_m age related hearing loss, early onset 17 (mouse) 5 82838468 116838597 Mouse
L23801
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 104,310,721 - 104,310,904 UniSTS GRCm38 MGSCv37 5 104,739,740 - 104,739,923 UniSTS GRCm37 Celera 5 92,506,790 - 92,506,973 UniSTS Cytogenetic Map 5 E5 UniSTS cM Map 5 56.0 UniSTS Whitehead/MRC_RH 5 1231.75 UniSTS Whitehead_YAC 5 UniSTS
Ibsp
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 104,310,541 - 104,310,806 UniSTS GRCm38 MGSCv37 5 104,739,560 - 104,739,825 UniSTS GRCm37 Celera 5 101,619,694 - 101,619,962 UniSTS Cytogenetic Map 5 E5 UniSTS cM Map 5 56.0 UniSTS
L23801
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 5 E5 UniSTS Whitehead/MRC_RH 5 1231.75 UniSTS
Ibsp
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 5 E5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000031246 ⟹ ENSMUSP00000031246
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 104,447,037 - 104,459,335 (+) Ensembl GRCm38.p6 Ensembl 5 104,299,171 - 104,311,469 (+) Ensembl
RefSeq Acc Id:
NM_008318 ⟹ NP_032344
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 104,447,153 - 104,459,338 (+) NCBI GRCm38 5 104,299,287 - 104,311,472 (+) ENTREZGENE MGSCv37 5 104,728,306 - 104,740,491 (+) RGD Celera 5 92,506,222 - 92,507,102 (-) NCBI cM Map 5 ENTREZGENE
Sequence:
GTGAGTGACAGCCGGGAGAACAATCCGTGCCACTCACTCGAGCCAGGACTGCCGAAAGGAAGGTTAAGAAGAAATTGCAAAATGAAGACTGCTTTAATTTTGCTCAGCATTTTGGGAATGGCCTGTGC
hide sequence
RefSeq Acc Id:
NP_032344 ⟸ NM_008318
- Peptide Label:
precursor
- UniProtKB:
Q61363 (UniProtKB/Swiss-Prot), Q80VR6 (UniProtKB/Swiss-Prot), Q61711 (UniProtKB/Swiss-Prot), Q3TRM5 (UniProtKB/TrEMBL)
- Sequence:
MKTALILLSILGMACAFSMKNFHRRIKAEDSEENGVFKYRPRYFLYKHAYFYPPLKRFPVQGGSDSSEENGDGDSSEEEGEEEETSNEEENNEDSEGNEDQEAEAENSTLSTLSGVTASYGAETTPQA
hide sequence
Ensembl Acc Id:
ENSMUSP00000031246 ⟸ ENSMUST00000031246
RGD ID: 6887352 Promoter ID: EPDNEW_M7127 Type: multiple initiation site Name: Ibsp_1 Description: Mus musculus integrin binding sialoprotein , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 104,299,289 - 104,299,349 EPDNEW
