Symbol:
Tgfbr2
Name:
transforming growth factor, beta receptor 2
RGD ID:
69651
Description:
Enables mitogen-activated protein kinase kinase kinase binding activity and transforming growth factor beta receptor activity, type II. Involved in several processes, including cellular response to acetaldehyde; negative regulation of cardiac muscle cell proliferation; and transforming growth factor beta receptor signaling pathway. Located in caveola and cell surface. Used to study membranoproliferative glomerulonephritis. Biomarker of artery disease (multiple); hepatobiliary system cancer (multiple); kidney disease; pulmonary fibrosis; and type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in several diseases, including Loeys-Dietz syndrome 2; Lynch syndrome (multiple); Marfan syndrome; gastrointestinal system cancer (multiple); and mismatch repair cancer syndrome. Orthologous to human TGFBR2 (transforming growth factor beta receptor 2); PARTICIPATES IN transforming growth factor-beta Smad dependent signaling pathway; altered transforming growth factor-beta Smad dependent signaling pathway; colorectal cancer pathway; INTERACTS WITH (S)-nicotine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
tbetaR-II; TGF-beta 2; TGF-beta receptor type II; TGF-beta receptor type-2; TGF-beta type II receptor; Tgfbr2T; TGFR-2; transforming growth factor beta receptor 2; transforming growth factor beta receptor type II; transforming growth factor beta, receptor 2; transforming growth factor, beta receptor II; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TGFBR2 (transforming growth factor beta receptor 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Tgfbr2 (transforming growth factor, beta receptor II) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tgfbr2 (transforming growth factor beta receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TGFBR2 (transforming growth factor beta receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TGFBR2 (transforming growth factor beta receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tgfbr2 (transforming growth factor beta receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TGFBR2 (transforming growth factor beta receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TGFBR2 (transforming growth factor beta receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tgfbr2 (transforming growth factor beta receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TGFBR2 (transforming growth factor beta receptor 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tgfbr2 (transforming growth factor, beta receptor II)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
daf-4
Alliance
DIOPT (Ensembl Compara|InParanoid|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
tgfbr2b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tgfbr2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Tgfbr2m2Mcwi
Tgfbr2m1Mcwi
Genetic Models:
BN-Tgfbr2m1Mcwi
FHH-Tgfbr2m2Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 124,672,677 - 124,761,741 (-) NCBI GRCr8 mRatBN7.2 8 115,794,537 - 115,883,615 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 115,794,537 - 115,883,228 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 121,401,503 - 121,487,689 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 119,600,574 - 119,686,750 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 117,443,698 - 117,530,245 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 124,310,288 - 124,399,345 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 124,312,754 - 124,399,494 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 123,585,765 - 123,671,209 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 120,593,595 - 120,680,453 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 120,613,331 - 120,700,190 (-) NCBI Celera 8 115,012,175 - 115,096,500 (-) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tgfbr2 Rat (1->4)-beta-D-glucan multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TGFBR2 mRNA CTD PMID:36331819 Tgfbr2 Rat (S)-amphetamine increases expression ISO Tgfbr2 (Mus musculus) 6480464 Dextroamphetamine results in increased expression of TGFBR2 mRNA CTD PMID:12205029 Tgfbr2 Rat (S)-amphetamine multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 SOD1 inhibits the reaction [Dextroamphetamine results in increased expression of TGFBR2 mRNA] CTD PMID:12205029 Tgfbr2 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of TGFBR2 mRNA CTD PMID:28555334 Tgfbr2 Rat 1,2-dimethylhydrazine multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TGFBR2 mRNA CTD PMID:22206623 Tgfbr2 Rat 17alpha-ethynylestradiol increases expression ISO Tgfbr2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of TGFBR2 mRNA CTD PMID:17942748 Tgfbr2 Rat 17alpha-ethynylestradiol multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TGFBR2 mRNA CTD PMID:17942748 Tgfbr2 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TGFBR2 mRNA CTD PMID:7585526 Tgfbr2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TGFBR2 mRNA CTD PMID:35192832 Tgfbr2 Rat 17beta-estradiol decreases expression ISO Tgfbr2 (Mus musculus) 6480464 Estradiol results in decreased expression of TGFBR2 mRNA CTD PMID:39298647 Tgfbr2 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of TGFBR2 mRNA CTD PMID:32145629 Tgfbr2 Rat 17beta-estradiol decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Estradiol results in decreased expression of TGFBR2 mRNA CTD PMID:35028925 Tgfbr2 Rat 17beta-estradiol increases expression ISO Tgfbr2 (Mus musculus) 6480464 Estradiol results in increased expression of TGFBR2 mRNA CTD PMID:19484750 Tgfbr2 Rat 17beta-estradiol multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [Estradiol co-treated with EGF protein] results in increased expression of TGFBR2 mRNA CTD PMID:24758408 Tgfbr2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 2 more ... CTD PMID:21851831 Tgfbr2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO Tgfbr2 (Mus musculus) 6480464 2 more ... CTD PMID:21851831 Tgfbr2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 2 more ... CTD PMID:17942748 and PMID:21851831 Tgfbr2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO TGFBR2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of TGFBR2 mRNA CTD PMID:31887333 Tgfbr2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TGFBR2 mRNA CTD PMID:20959002 and PMID:34747641 Tgfbr2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tgfbr2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TGFBR2 mRNA CTD PMID:21570461 Tgfbr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tgfbr2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TGFBR2 mRNA CTD PMID:21851831 Tgfbr2 Rat 2-butoxyethanol decreases expression ISO Tgfbr2 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of TGFBR2 mRNA CTD PMID:19812364 Tgfbr2 Rat 2-nitrotoluene increases expression EXP 6480464 2-nitrotoluene results in increased expression of TGFBR2 mRNA CTD PMID:16460773 Tgfbr2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Tgfbr2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of TGFBR2 mRNA CTD PMID:20188158 Tgfbr2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of TGFBR2 mRNA CTD PMID:28628672 Tgfbr2 Rat 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine increases expression ISO Tgfbr2 (Mus musculus) 6480464 2-amino-3-methylimidazo(4 and 5-f)quinoline results in increased expression of TGFBR2 protein CTD PMID:22094457 Tgfbr2 Rat 4,4'-diaminodiphenylmethane increases expression ISO Tgfbr2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of TGFBR2 mRNA CTD PMID:18648102 Tgfbr2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of TGFBR2 mRNA CTD PMID:30951980 Tgfbr2 Rat 4,4'-sulfonyldiphenol increases expression ISO Tgfbr2 (Mus musculus) 6480464 bisphenol S results in increased expression of TGFBR2 mRNA CTD PMID:30951980 and PMID:39298647 Tgfbr2 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO Tgfbr2 (Mus musculus) 6480464 Oxazolone results in decreased expression of TGFBR2 mRNA CTD PMID:21404309 Tgfbr2 Rat 4-nitrophenol decreases expression ISO Tgfbr2 (Mus musculus) 6480464 4-nitrophenol results in decreased expression of TGFBR2 mRNA CTD PMID:34673133 Tgfbr2 Rat 4-vinylcyclohexene dioxide affects expression ISO Tgfbr2 (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of TGFBR2 mRNA CTD PMID:20829426 Tgfbr2 Rat 5-aza-2'-deoxycytidine increases expression ISO Tgfbr2 (Mus musculus) 6480464 Decitabine results in increased expression of TGFBR2 mRNA CTD PMID:27915011 Tgfbr2 Rat 5-aza-2'-deoxycytidine multiple interactions EXP 6480464 [Decitabine affects the methylation of TGFBR2 protein] which affects the expression of TGFBR2 mRNA CTD PMID:18381416 Tgfbr2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TGFBR2 mRNA CTD PMID:39441382 Tgfbr2 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 TGFBR2 protein affects the reaction [Uric Acid inhibits the reaction [Lipopolysaccharides results in increased secretion of IL1RN protein]] and TGFBR2 protein affects the reaction [Uric Acid promotes the reaction [Lipopolysaccharides results in increased secretion of IL1B protein]] CTD PMID:36850003 Tgfbr2 Rat 8-Br-cAMP decreases expression ISO TGFBR2 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of TGFBR2 mRNA CTD PMID:22079614 Tgfbr2 Rat acetaldehyde increases expression EXP 6480464 Acetaldehyde results in increased expression of TGFBR2 mRNA CTD PMID:12223100 Tgfbr2 Rat acetaldehyde multiple interactions EXP 6480464 JUN protein promotes the reaction [Acetaldehyde results in increased expression of TGFBR2 mRNA] more ... CTD PMID:12223100 Tgfbr2 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of TGFBR2 mRNA CTD PMID:31881176 Tgfbr2 Rat acteoside decreases expression ISO TGFBR2 (Homo sapiens) 6480464 acteoside results in decreased expression of TGFBR2 protein CTD PMID:33522686 Tgfbr2 Rat aflatoxin B1 decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of TGFBR2 mRNA CTD PMID:28943387 Tgfbr2 Rat Aflatoxin B2 alpha increases methylation ISO TGFBR2 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of TGFBR2 intron CTD PMID:30157460 Tgfbr2 Rat aldehydo-D-glucose increases expression ISO TGFBR2 (Homo sapiens) 6480464 Glucose results in increased expression of TGFBR2 protein CTD PMID:21367880 Tgfbr2 Rat aldehydo-D-glucose multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 isoangustone A inhibits the reaction [Glucose results in increased expression of TGFBR2 protein] CTD PMID:21367880 Tgfbr2 Rat all-trans-retinoic acid affects expression ISO Tgfbr2 (Mus musculus) 6480464 Tretinoin affects the expression of TGFBR2 mRNA CTD PMID:16235736 Tgfbr2 Rat all-trans-retinoic acid increases expression ISO TGFBR2 (Homo sapiens) 6480464 Tretinoin results in increased expression of TGFBR2 mRNA CTD PMID:33167477 Tgfbr2 Rat all-trans-retinoic acid multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of TGFBR2 mRNA more ... CTD PMID:30951980 Tgfbr2 Rat all-trans-retinoic acid decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TGFBR2 CTD PMID:24374174 Tgfbr2 Rat all-trans-retinoic acid decreases expression ISO Tgfbr2 (Mus musculus) 6480464 Tretinoin results in decreased expression of TGFBR2 mRNA CTD PMID:15389595 and PMID:16410076 Tgfbr2 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of TGFBR2 mRNA CTD PMID:24977338 Tgfbr2 Rat all-trans-retinol increases expression ISO TGFBR2 (Homo sapiens) 6480464 Vitamin A results in increased expression of TGFBR2 mRNA CTD PMID:17225872 Tgfbr2 Rat aluminium oxide increases expression ISO TGFBR2 (Homo sapiens) 6480464 Aluminum Oxide results in increased expression of TGFBR2 mRNA CTD PMID:19464052 Tgfbr2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TGFBR2 mRNA CTD PMID:16483693 Tgfbr2 Rat antirheumatic drug decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of TGFBR2 mRNA CTD PMID:25339124 Tgfbr2 Rat arsane affects expression ISO TGFBR2 (Homo sapiens) 6480464 Arsenic affects the expression of TGFBR2 protein CTD PMID:24675094 Tgfbr2 Rat arsane affects methylation ISO TGFBR2 (Homo sapiens) 6480464 Arsenic affects the methylation of TGFBR2 gene CTD PMID:25304211 Tgfbr2 Rat arsenic atom affects expression ISO TGFBR2 (Homo sapiens) 6480464 Arsenic affects the expression of TGFBR2 protein CTD PMID:24675094 Tgfbr2 Rat arsenic atom affects methylation ISO TGFBR2 (Homo sapiens) 6480464 Arsenic affects the methylation of TGFBR2 gene CTD PMID:25304211 Tgfbr2 Rat arsenite(3-) affects expression ISO Tgfbr2 (Mus musculus) 6480464 arsenite affects the expression of TGFBR2 mRNA CTD PMID:33010264 Tgfbr2 Rat arsenous acid decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TGFBR2 mRNA CTD PMID:12852829 and PMID:22521957 Tgfbr2 Rat asbestos multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [Asbestos and Serpentine results in decreased susceptibility to Asbestos] which results in decreased expression of TGFBR2 mRNA CTD PMID:25358858 Tgfbr2 Rat avobenzone increases expression ISO TGFBR2 (Homo sapiens) 6480464 avobenzone results in increased expression of TGFBR2 mRNA CTD PMID:31016361 Tgfbr2 Rat azoxystrobin decreases expression ISO TGFBR2 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of TGFBR2 mRNA CTD PMID:33512557 Tgfbr2 Rat bellidifolin multiple interactions EXP 6480464 bellidifolin inhibits the reaction [TGFB1 protein results in increased expression of and results in increased phosphorylation of TGFBR2 protein] CTD PMID:33995055 Tgfbr2 Rat benzo[a]pyrene decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TGFBR2 mRNA CTD PMID:20106945 and PMID:21632981 Tgfbr2 Rat benzo[a]pyrene decreases methylation ISO TGFBR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TGFBR2 3' UTR and Benzo(a)pyrene results in decreased methylation of TGFBR2 promoter CTD PMID:27901495 Tgfbr2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO TGFBR2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Tgfbr2 Rat benzo[b]fluoranthene increases expression ISO Tgfbr2 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of TGFBR2 mRNA CTD PMID:26377693 Tgfbr2 Rat benzo[e]pyrene increases methylation ISO TGFBR2 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of TGFBR2 intron CTD PMID:30157460 Tgfbr2 Rat beta-lapachone decreases expression ISO TGFBR2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of TGFBR2 mRNA CTD PMID:38218311 Tgfbr2 Rat bis(2-ethylhexyl) phthalate increases expression ISO TGFBR2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of TGFBR2 mRNA CTD PMID:31163220 Tgfbr2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TGFBR2 mRNA CTD PMID:25181051 and PMID:32145629 Tgfbr2 Rat bisphenol A decreases expression ISO TGFBR2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of TGFBR2 protein CTD PMID:33376534 Tgfbr2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TGFBR2 mRNA CTD PMID:34097993 and PMID:38750585 Tgfbr2 Rat bisphenol A increases expression ISO Tgfbr2 (Mus musculus) 6480464 bisphenol A results in increased expression of TGFBR2 mRNA CTD PMID:30951980 more ... Tgfbr2 Rat bisphenol A multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of TGFBR2 mRNA CTD PMID:30951980 Tgfbr2 Rat bisphenol A multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of TGFBR2 mRNA CTD PMID:28628672 Tgfbr2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TGFBR2 gene CTD PMID:28505145 Tgfbr2 Rat bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of TGFBR2 mRNA CTD PMID:27567155 Tgfbr2 Rat bisphenol F increases expression ISO Tgfbr2 (Mus musculus) 6480464 bisphenol F results in increased expression of TGFBR2 mRNA CTD PMID:30951980 Tgfbr2 Rat bisphenol F multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of TGFBR2 mRNA CTD PMID:30951980 Tgfbr2 Rat bleomycin A2 multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [CCL12 protein co-treated with Dinoprostone] affects the reaction [Bleomycin results in increased expression of TGFBR2 mRNA] more ... CTD PMID:28434932 Tgfbr2 Rat bromochloroacetic acid increases expression EXP 6480464 bromochloroacetic acid results in increased expression of TGFBR2 mRNA CTD PMID:16460773 Tgfbr2 Rat butan-1-ol multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of TGFBR2 mRNA CTD PMID:29432896 Tgfbr2 Rat cadmium atom increases expression ISO TGFBR2 (Homo sapiens) 6480464 Cadmium results in increased expression of TGFBR2 mRNA CTD PMID:22562489 Tgfbr2 Rat cadmium dichloride decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TGFBR2 mRNA CTD PMID:26472689 and PMID:38568856 Tgfbr2 Rat cadmium dichloride increases expression ISO TGFBR2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TGFBR2 mRNA CTD PMID:38382870 Tgfbr2 Rat caffeine affects phosphorylation ISO TGFBR2 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of TGFBR2 protein CTD PMID:35688186 Tgfbr2 Rat calciol increases expression ISO Tgfbr2 (Mus musculus) 6480464 Cholecalciferol results in increased expression of TGFBR2 mRNA CTD PMID:17170073 Tgfbr2 Rat calcitriol multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of TGFBR2 mRNA CTD PMID:21592394 Tgfbr2 Rat calcitriol increases expression ISO TGFBR2 (Homo sapiens) 6480464 Calcitriol results in increased expression of TGFBR2 mRNA CTD PMID:21592394 Tgfbr2 Rat Candesartan cilexetil multiple interactions EXP 6480464 candesartan cilexetil inhibits the reaction [sodium arsenite results in increased expression of TGFBR2 protein] CTD PMID:27889505 Tgfbr2 Rat cannabidiol affects methylation EXP 6480464 Cannabidiol affects the methylation of TGFBR2 gene CTD PMID:30521419 Tgfbr2 Rat carbamazepine affects expression ISO TGFBR2 (Homo sapiens) 6480464 Carbamazepine affects the expression of TGFBR2 mRNA CTD PMID:25979313 Tgfbr2 Rat carbon nanotube increases expression ISO Tgfbr2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Tgfbr2 Rat CGP 52608 multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TGFBR2 gene] CTD PMID:28238834 Tgfbr2 Rat chloropicrin decreases expression ISO TGFBR2 (Homo sapiens) 6480464 chloropicrin results in decreased expression of TGFBR2 mRNA CTD PMID:26352163 and PMID:28476498 Tgfbr2 Rat chromium(6+) affects expression ISO Tgfbr2 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of TGFBR2 mRNA CTD PMID:28472532 Tgfbr2 Rat cisplatin increases expression ISO Tgfbr2 (Mus musculus) 6480464 Cisplatin results in increased expression of TGFBR2 mRNA CTD PMID:21151649 Tgfbr2 Rat cobalt dichloride decreases expression ISO TGFBR2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of TGFBR2 mRNA CTD PMID:19320972 Tgfbr2 Rat copper atom multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of TGFBR2 mRNA CTD PMID:15467011 Tgfbr2 Rat copper atom multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of TGFBR2 mRNA CTD PMID:30911355 Tgfbr2 Rat copper(0) multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of TGFBR2 mRNA CTD PMID:15467011 Tgfbr2 Rat copper(0) multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of TGFBR2 mRNA CTD PMID:30911355 Tgfbr2 Rat copper(II) sulfate increases expression ISO TGFBR2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of TGFBR2 mRNA CTD PMID:19549813 Tgfbr2 Rat curcumin multiple interactions EXP 6480464 Buthionine Sulfoximine inhibits the reaction [Curcumin results in decreased expression of TGFBR2 mRNA] and Buthionine Sulfoximine inhibits the reaction [Curcumin results in decreased expression of TGFBR2 protein] CTD PMID:17602960 Tgfbr2 Rat curcumin decreases expression EXP 6480464 Curcumin results in decreased expression of TGFBR2 mRNA and Curcumin results in decreased expression of TGFBR2 protein CTD PMID:16959952 and PMID:17602960 Tgfbr2 Rat cycloheximide multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [tolfenamic acid results in decreased expression of TGFBR2 protein] CTD PMID:31381904 Tgfbr2 Rat cyclophosphamide increases expression ISO Tgfbr2 (Mus musculus) 6480464 Cyclophosphamide results in increased expression of TGFBR2 mRNA CTD PMID:21041162 Tgfbr2 Rat cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of TGFBR2 mRNA and Cyclophosphamide results in increased expression of TGFBR2 protein CTD PMID:23926183 Tgfbr2 Rat cyclosporin A decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TGFBR2 mRNA CTD PMID:20106945 Tgfbr2 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of TGFBR2 protein CTD PMID:16980036 Tgfbr2 Rat cyproconazole increases expression ISO Tgfbr2 (Mus musculus) 6480464 cyproconazole results in increased expression of TGFBR2 mRNA CTD PMID:22334560 Tgfbr2 Rat D-glucose increases expression ISO TGFBR2 (Homo sapiens) 6480464 Glucose results in increased expression of TGFBR2 protein CTD PMID:21367880 Tgfbr2 Rat D-glucose multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 isoangustone A inhibits the reaction [Glucose results in increased expression of TGFBR2 protein] CTD PMID:21367880 Tgfbr2 Rat deguelin decreases expression ISO TGFBR2 (Homo sapiens) 6480464 deguelin results in decreased expression of TGFBR2 mRNA CTD PMID:33512557 Tgfbr2 Rat dexamethasone increases expression ISO Tgfbr2 (Mus musculus) 6480464 Dexamethasone results in increased expression of TGFBR2 mRNA CTD PMID:21041162 Tgfbr2 Rat dexamethasone multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of TGFBR2 mRNA CTD PMID:28628672 Tgfbr2 Rat dexamethasone increases expression ISO TGFBR2 (Homo sapiens) 6480464 Dexamethasone results in increased expression of TGFBR2 mRNA CTD PMID:12732289 and PMID:12782123 Tgfbr2 Rat diarsenic trioxide decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TGFBR2 mRNA CTD PMID:12852829 and PMID:22521957 Tgfbr2 Rat diazepam increases expression ISO TGFBR2 (Homo sapiens) 6480464 Diazepam results in increased expression of TGFBR2 mRNA CTD PMID:19114084 Tgfbr2 Rat diethylstilbestrol increases expression ISO Tgfbr2 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of TGFBR2 mRNA CTD PMID:21041162 Tgfbr2 Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of TGFBR2 mRNA CTD PMID:17481689 Tgfbr2 Rat dioxygen increases expression ISO Tgfbr2 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of TGFBR2 mRNA CTD PMID:16373842 Tgfbr2 Rat dioxygen multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 Simvastatin inhibits the reaction [Oxygen deficiency results in increased expression of TGFBR2 mRNA] CTD PMID:16373842 Tgfbr2 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of TGFBR2 mRNA CTD PMID:21551480 Tgfbr2 Rat doxorubicin multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [[MT1 protein co-treated with MT2 protein] affects the susceptibility to Doxorubicin] which affects the expression of TGFBR2 mRNA CTD PMID:21040762 Tgfbr2 Rat doxorubicin affects expression ISO TGFBR2 (Homo sapiens) 6480464 Doxorubicin affects the expression of TGFBR2 mRNA CTD PMID:29803840 Tgfbr2 Rat doxycycline multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 Doxycycline inhibits the reaction [Isoproterenol results in increased expression of TGFBR2 mRNA] CTD PMID:18089841 Tgfbr2 Rat epoxiconazole increases expression ISO Tgfbr2 (Mus musculus) 6480464 epoxiconazole results in increased expression of TGFBR2 mRNA CTD PMID:22334560 Tgfbr2 Rat epoxiconazole decreases expression ISO Tgfbr2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of TGFBR2 mRNA CTD PMID:35436446 Tgfbr2 Rat ethanol multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of TGFBR2 mRNA CTD PMID:29432896 Tgfbr2 Rat ethanol multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [Dietary Fats co-treated with Cholesterol more ... CTD PMID:37271273 Tgfbr2 Rat ethanol increases expression ISO Tgfbr2 (Mus musculus) 6480464 Ethanol results in increased expression of TGFBR2 mRNA and Ethanol results in increased expression of TGFBR2 protein CTD PMID:30319688 and PMID:37271273 Tgfbr2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of TGFBR2 mRNA and Flutamide results in decreased expression of TGFBR2 protein CTD PMID:16166221 Tgfbr2 Rat folic acid multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TGFBR2 mRNA CTD PMID:22206623 Tgfbr2 Rat folic acid decreases expression ISO Tgfbr2 (Mus musculus) 6480464 Folic Acid results in decreased expression of TGFBR2 mRNA CTD PMID:25629700 Tgfbr2 Rat folic acid decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Folic Acid results in decreased expression of TGFBR2 mRNA CTD PMID:21867686 Tgfbr2 Rat FR900359 increases phosphorylation ISO TGFBR2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of TGFBR2 protein CTD PMID:37730182 Tgfbr2 Rat fructose multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [Dietary Fats co-treated with Cholesterol more ... CTD PMID:37271273 Tgfbr2 Rat furosemide increases expression EXP 6480464 Furosemide results in increased expression of TGFBR2 mRNA CTD PMID:16526316 Tgfbr2 Rat galangin increases expression ISO TGFBR2 (Homo sapiens) 6480464 galangin results in increased expression of TGFBR2 mRNA CTD PMID:25268046 Tgfbr2 Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of TGFBR2 mRNA CTD PMID:21782745 Tgfbr2 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of TGFBR2 mRNA CTD PMID:21782745 Tgfbr2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TGFBR2 mRNA CTD PMID:22061828 Tgfbr2 Rat glucose increases expression ISO TGFBR2 (Homo sapiens) 6480464 Glucose results in increased expression of TGFBR2 protein CTD PMID:21367880 Tgfbr2 Rat glucose multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 isoangustone A inhibits the reaction [Glucose results in increased expression of TGFBR2 protein] CTD PMID:21367880 Tgfbr2 Rat glycyrrhizinic acid decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Glycyrrhizic Acid results in decreased expression of TGFBR2 protein CTD PMID:33522686 Tgfbr2 Rat glyphosate decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Glyphosate results in decreased expression of TGFBR2 mRNA CTD PMID:31295307 Tgfbr2 Rat hexachlorobenzene affects expression ISO Tgfbr2 (Mus musculus) 6480464 Hexachlorobenzene affects the expression of TGFBR2 mRNA CTD PMID:28923513 Tgfbr2 Rat hexachlorobenzene multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 Hexachlorobenzene affects the reaction [AHR protein affects the expression of TGFBR2 mRNA] CTD PMID:28923513 Tgfbr2 Rat hydrogen peroxide affects expression ISO TGFBR2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of TGFBR2 mRNA CTD PMID:20044591 Tgfbr2 Rat indometacin multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of TGFBR2 mRNA CTD PMID:28628672 Tgfbr2 Rat inulin multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of TGFBR2 mRNA CTD PMID:36331819 Tgfbr2 Rat Isoangustone A multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 isoangustone A inhibits the reaction [Glucose results in increased expression of TGFBR2 protein] CTD PMID:21367880 Tgfbr2 Rat isobutanol multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of TGFBR2 mRNA CTD PMID:29432896 Tgfbr2 Rat isoprenaline multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 Doxycycline inhibits the reaction [Isoproterenol results in increased expression of TGFBR2 mRNA] CTD PMID:18089841 Tgfbr2 Rat isoprenaline increases expression ISO Tgfbr2 (Mus musculus) 6480464 Isoproterenol results in increased expression of TGFBR2 mRNA CTD PMID:18089841 and PMID:20003209 Tgfbr2 Rat isotretinoin increases expression ISO TGFBR2 (Homo sapiens) 6480464 Isotretinoin results in increased expression of TGFBR2 mRNA CTD PMID:20436886 Tgfbr2 Rat ketamine increases expression ISO TGFBR2 (Homo sapiens) 6480464 Ketamine results in increased expression of TGFBR2 mRNA CTD PMID:28331066 Tgfbr2 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of TGFBR2 mRNA CTD PMID:37077353 Tgfbr2 Rat L-cysteine decreases expression EXP 6480464 Cysteine results in decreased expression of TGFBR2 protein CTD PMID:15158331 Tgfbr2 Rat L-methionine decreases expression EXP 6480464 Methionine results in decreased expression of TGFBR2 protein CTD PMID:15158331 Tgfbr2 Rat lead(0) affects methylation ISO TGFBR2 (Homo sapiens) 6480464 Lead affects the methylation of TGFBR2 gene CTD PMID:31636367 Tgfbr2 Rat leflunomide decreases expression ISO TGFBR2 (Homo sapiens) 6480464 leflunomide results in decreased expression of TGFBR2 mRNA CTD PMID:28988120 Tgfbr2 Rat lipopolysaccharide multiple interactions EXP 6480464 [Thioacetamide co-treated with Lipopolysaccharides] results in decreased expression of TGFBR2 mRNA and [Thioacetamide co-treated with Lipopolysaccharides] results in decreased expression of TGFBR2 protein CTD PMID:17621560 Tgfbr2 Rat lipopolysaccharide decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of TGFBR2 mRNA CTD PMID:35811015 Tgfbr2 Rat lipopolysaccharide multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 and PMID:36850003 Tgfbr2 Rat lithium chloride increases expression ISO TGFBR2 (Homo sapiens) 6480464 Lithium Chloride results in increased expression of TGFBR2 mRNA CTD PMID:23527032 Tgfbr2 Rat lithocholic acid increases expression ISO Tgfbr2 (Mus musculus) 6480464 Lithocholic Acid results in increased expression of TGFBR2 mRNA CTD PMID:23034213 Tgfbr2 Rat medroxyprogesterone acetate increases expression ISO TGFBR2 (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in increased expression of TGFBR2 mRNA CTD PMID:20843944 Tgfbr2 Rat menadione affects expression ISO TGFBR2 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of TGFBR2 mRNA CTD PMID:20044591 Tgfbr2 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of TGFBR2 mRNA CTD PMID:15644446 Tgfbr2 Rat methamphetamine increases expression ISO Tgfbr2 (Mus musculus) 6480464 Methamphetamine results in increased expression of TGFBR2 mRNA CTD PMID:12766323 Tgfbr2 Rat methapyrilene increases methylation ISO TGFBR2 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of TGFBR2 intron CTD PMID:30157460 Tgfbr2 Rat methotrexate decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Methotrexate results in decreased expression of TGFBR2 mRNA CTD PMID:25339124 Tgfbr2 Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of TGFBR2 mRNA CTD PMID:21782745 Tgfbr2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of TGFBR2 gene CTD PMID:35440735 Tgfbr2 Rat methoxychlor increases expression EXP 6480464 Methoxychlor results in increased expression of TGFBR2 mRNA CTD PMID:21782745 Tgfbr2 Rat methyl beta-cyclodextrin multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 methyl-beta-cyclodextrin inhibits the reaction [tolfenamic acid results in decreased expression of TGFBR2 protein] CTD PMID:31381904 Tgfbr2 Rat methylarsonic acid increases expression EXP 6480464 monomethylarsonic acid results in increased expression of TGFBR2 mRNA CTD PMID:17481689 Tgfbr2 Rat Methylazoxymethanol acetate increases expression EXP 6480464 Methylazoxymethanol Acetate results in increased expression of TGFBR2 mRNA CTD PMID:28349193 Tgfbr2 Rat methylmercury chloride decreases expression ISO TGFBR2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of TGFBR2 mRNA CTD PMID:28001369 Tgfbr2 Rat methylseleninic acid increases expression ISO TGFBR2 (Homo sapiens) 6480464 methylselenic acid results in increased expression of TGFBR2 mRNA CTD PMID:18548127 Tgfbr2 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases expression ISO TGFBR2 (Homo sapiens) 6480464 N more ... CTD PMID:12756304 Tgfbr2 Rat N-acetyl-L-cysteine decreases expression EXP 6480464 Acetylcysteine results in decreased expression of TGFBR2 mRNA and Acetylcysteine results in decreased expression of TGFBR2 protein CTD PMID:17602960 Tgfbr2 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Buthionine Sulfoximine inhibits the reaction [Acetylcysteine results in decreased expression of TGFBR2 mRNA] and Buthionine Sulfoximine inhibits the reaction [Acetylcysteine results in decreased expression of TGFBR2 protein] CTD PMID:17602960 Tgfbr2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of TGFBR2 mRNA more ... CTD PMID:8001232 and PMID:8565130 Tgfbr2 Rat N-nitrosodiethylamine multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Diethylnitrosamine] results in increased expression of TGFBR2 mRNA CTD PMID:26778414 Tgfbr2 Rat N-nitrosodiethylamine increases expression ISO Tgfbr2 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of TGFBR2 mRNA CTD PMID:24535843 Tgfbr2 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of TGFBR2 protein CTD PMID:16009107 Tgfbr2 Rat N-nitrosodimethylamine multiple interactions EXP 6480464 salvianolic acid B inhibits the reaction [Dimethylnitrosamine results in increased expression of TGFBR2 protein] CTD PMID:16009107 Tgfbr2 Rat N-Vinyl-2-pyrrolidone multiple interactions EXP 6480464 [N-vinyl-2-pyrrolidinone binds to N-vinyl-2-pyrrolidinone] which results in increased expression of TGFBR2 mRNA CTD PMID:22037397 Tgfbr2 Rat nickel sulfate decreases expression ISO TGFBR2 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of TGFBR2 mRNA CTD PMID:22714537 Tgfbr2 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of TGFBR2 mRNA CTD PMID:28555334 Tgfbr2 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of TGFBR2 mRNA and nitrofen results in decreased expression of TGFBR2 protein CTD PMID:20638522 and PMID:27822781 Tgfbr2 Rat osthole multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [platycodin D co-treated with osthol] results in decreased expression of TGFBR2 mRNA and [platycodin D co-treated with osthol] results in decreased expression of TGFBR2 protein CTD PMID:23603464 Tgfbr2 Rat oxalic acid multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 resveratrol inhibits the reaction [Oxalic Acid results in increased expression of TGFBR2 protein] CTD PMID:24145091 Tgfbr2 Rat ozone multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of TGFBR2 mRNA CTD PMID:34911549 Tgfbr2 Rat paracetamol affects expression ISO Tgfbr2 (Mus musculus) 6480464 Acetaminophen affects the expression of TGFBR2 mRNA CTD PMID:17562736 Tgfbr2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TGFBR2 mRNA CTD PMID:33387578 Tgfbr2 Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of TGFBR2 mRNA CTD PMID:16854511 Tgfbr2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of TGFBR2 mRNA CTD PMID:17077588 and PMID:18198484 Tgfbr2 Rat patulin increases expression EXP 6480464 Patulin results in increased expression of TGFBR2 protein CTD PMID:34896196 Tgfbr2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TGFBR2 mRNA more ... CTD PMID:36331819 Tgfbr2 Rat perfluorooctanoic acid decreases expression ISO TGFBR2 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of TGFBR2 protein CTD PMID:26879310 Tgfbr2 Rat perindopril decreases expression EXP 6480464 Perindopril results in decreased expression of TGFBR2 mRNA CTD PMID:15619341 Tgfbr2 Rat perindopril multiple interactions EXP 6480464 Perindopril inhibits the reaction [Carbon Tetrachloride results in increased expression of TGFBR2 mRNA] CTD PMID:16872305 Tgfbr2 Rat phenobarbital multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 NR1I3 protein promotes the reaction [Phenobarbital results in increased expression of TGFBR2 mRNA] CTD PMID:19482888 Tgfbr2 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of TGFBR2 mRNA CTD PMID:22037397 Tgfbr2 Rat phenobarbital multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of TGFBR2 mRNA more ... CTD PMID:8001232 and PMID:8565130 Tgfbr2 Rat phenobarbital increases expression ISO Tgfbr2 (Mus musculus) 6480464 Phenobarbital results in increased expression of TGFBR2 mRNA CTD PMID:19482888 Tgfbr2 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of TGFBR2 mRNA CTD PMID:19443575 Tgfbr2 Rat picoxystrobin decreases expression ISO TGFBR2 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of TGFBR2 mRNA CTD PMID:33512557 Tgfbr2 Rat pirinixic acid multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of TGFBR2 mRNA CTD PMID:19710929 Tgfbr2 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of TGFBR2 mRNA CTD PMID:19162173 Tgfbr2 Rat platycodin D multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [platycodin D co-treated with osthol] results in decreased expression of TGFBR2 mRNA and [platycodin D co-treated with osthol] results in decreased expression of TGFBR2 protein CTD PMID:23603464 Tgfbr2 Rat potassium chromate decreases expression ISO TGFBR2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of TGFBR2 mRNA CTD PMID:22714537 Tgfbr2 Rat progesterone increases expression ISO TGFBR2 (Homo sapiens) 6480464 Progesterone results in increased expression of TGFBR2 mRNA CTD PMID:21795739 Tgfbr2 Rat propiconazole increases expression ISO Tgfbr2 (Mus musculus) 6480464 propiconazole results in increased expression of TGFBR2 mRNA CTD PMID:21278054 and PMID:22334560 Tgfbr2 Rat prostaglandin E2 multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [CCL12 protein co-treated with Dinoprostone] affects the reaction [Bleomycin results in increased expression of TGFBR2 mRNA] more ... CTD PMID:28434932 Tgfbr2 Rat quercetin decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Quercetin results in decreased expression of TGFBR2 protein CTD PMID:15580028 Tgfbr2 Rat quercetin increases expression ISO TGFBR2 (Homo sapiens) 6480464 Quercetin results in increased expression of TGFBR2 mRNA CTD PMID:14715546 Tgfbr2 Rat raloxifene affects expression ISO TGFBR2 (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of TGFBR2 mRNA CTD PMID:14699072 Tgfbr2 Rat resveratrol increases expression ISO TGFBR2 (Homo sapiens) 6480464 resveratrol results in increased expression of TGFBR2 protein CTD PMID:20637737 Tgfbr2 Rat resveratrol multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 resveratrol inhibits the reaction [Oxalic Acid results in increased expression of TGFBR2 protein] CTD PMID:24145091 Tgfbr2 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of TGFBR2 mRNA CTD PMID:28374803 Tgfbr2 Rat rotenone decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Rotenone results in decreased expression of TGFBR2 mRNA CTD PMID:29955902 and PMID:33512557 Tgfbr2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Tgfbr2 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions EXP 6480464 Buthionine Sulfoximine inhibits the reaction [Acetylcysteine results in decreased expression of TGFBR2 mRNA] more ... CTD PMID:17602960 Tgfbr2 Rat salvianolic acid B multiple interactions EXP 6480464 salvianolic acid B inhibits the reaction [Dimethylnitrosamine results in increased expression of TGFBR2 protein] CTD PMID:16009107 Tgfbr2 Rat SB 431542 multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Sodium Fluoride results in increased expression of TGFBR2 mRNA] CTD PMID:29127033 Tgfbr2 Rat serpentine asbestos multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [Asbestos and Serpentine results in decreased susceptibility to Asbestos] which results in decreased expression of TGFBR2 mRNA CTD PMID:25358858 Tgfbr2 Rat silicon dioxide decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of TGFBR2 mRNA CTD PMID:34973136 Tgfbr2 Rat simvastatin multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 Simvastatin inhibits the reaction [Oxygen deficiency results in increased expression of TGFBR2 mRNA] CTD PMID:16373842 Tgfbr2 Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of TGFBR2 mRNA CTD PMID:16320597 Tgfbr2 Rat sodium arsenite decreases expression ISO TGFBR2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TGFBR2 mRNA CTD PMID:20886546 and PMID:38568856 Tgfbr2 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of TGFBR2 protein CTD PMID:27889505 Tgfbr2 Rat sodium arsenite multiple interactions EXP 6480464 candesartan cilexetil inhibits the reaction [sodium arsenite results in increased expression of TGFBR2 protein] CTD PMID:27889505 Tgfbr2 Rat sodium fluoride multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Sodium Fluoride results in increased expression of TGFBR2 mRNA] CTD PMID:29127033 Tgfbr2 Rat sodium fluoride increases expression ISO Tgfbr2 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of TGFBR2 mRNA CTD PMID:29127033 Tgfbr2 Rat streptozocin decreases expression ISO Tgfbr2 (Mus musculus) 6480464 Streptozocin results in decreased expression of TGFBR2 protein CTD PMID:15496156 Tgfbr2 Rat succimer multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of TGFBR2 mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of TGFBR2 mRNA CTD PMID:21641980 and PMID:26378955 Tgfbr2 Rat T-2 toxin increases expression EXP 6480464 T-2 Toxin results in increased expression of TGFBR2 protein CTD PMID:35213812 Tgfbr2 Rat tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of TGFBR2 mRNA and Tacrolimus results in increased expression of TGFBR2 protein CTD PMID:16980036 Tgfbr2 Rat testosterone multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of TGFBR2 mRNA CTD PMID:21592394 Tgfbr2 Rat testosterone decreases expression ISO Tgfbr2 (Mus musculus) 6480464 Testosterone results in decreased expression of TGFBR2 mRNA CTD PMID:22138414 Tgfbr2 Rat testosterone increases expression ISO TGFBR2 (Homo sapiens) 6480464 Testosterone results in increased expression of TGFBR2 mRNA CTD PMID:21592394 Tgfbr2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TGFBR2 mRNA CTD PMID:15818738 more ... Tgfbr2 Rat tetrachloromethane increases expression ISO Tgfbr2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TGFBR2 mRNA CTD PMID:25827057 Tgfbr2 Rat tetrachloromethane multiple interactions ISO Tgfbr2 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Diethylnitrosamine] results in increased expression of TGFBR2 mRNA CTD PMID:26778414 Tgfbr2 Rat tetrachloromethane multiple interactions EXP 6480464 Drugs more ... CTD PMID:15818738 more ... Tgfbr2 Rat thioacetamide multiple interactions EXP 6480464 [Thioacetamide co-treated with Lipopolysaccharides] results in decreased expression of TGFBR2 mRNA and [Thioacetamide co-treated with Lipopolysaccharides] results in decreased expression of TGFBR2 protein CTD PMID:17621560 Tgfbr2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TGFBR2 mRNA CTD PMID:28181416 Tgfbr2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TGFBR2 mRNA CTD PMID:17621560 Tgfbr2 Rat thiram decreases expression ISO TGFBR2 (Homo sapiens) 6480464 Thiram results in decreased expression of TGFBR2 mRNA CTD PMID:38568856 Tgfbr2 Rat tipifarnib increases expression EXP 6480464 tipifarnib results in increased expression of TGFBR2 mRNA CTD PMID:16403772 Tgfbr2 Rat tolfenamic acid decreases expression ISO TGFBR2 (Homo sapiens) 6480464 tolfenamic acid results in decreased expression of TGFBR2 protein CTD PMID:31381904 Tgfbr2 Rat tolfenamic acid multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 CAV1 protein affects the reaction [tolfenamic acid results in decreased expression of TGFBR2 protein] more ... CTD PMID:31381904 Tgfbr2 Rat toluene 2,4-diisocyanate decreases expression ISO Tgfbr2 (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in decreased expression of TGFBR2 mRNA CTD PMID:21404309 Tgfbr2 Rat torcetrapib increases expression ISO TGFBR2 (Homo sapiens) 6480464 torcetrapib results in increased expression of TGFBR2 mRNA CTD PMID:23228038 Tgfbr2 Rat tranilast affects expression EXP 329845558 tranilast inhibits the reaction [TGF-b1 increases mRNA expression in rat carotid artery smooth muscle cell culture] RGD Tgfbr2 Rat tranilast multiple interactions EXP 329845558 tranilast inhibits the reaction [PDGF-BB increases mRNA expression in rat carotid artery smooth muscle cell culture] RGD Tgfbr2 Rat tranilast decreases expression EXP 329845558 tranilast inhibits the reaction [balloon angioplasty increases mRNA expression in rat carotid artery] RGD Tgfbr2 Rat trichostatin A multiple interactions ISO TGFBR2 (Homo sapiens) 6480464 trichostatin A promotes the reaction [EP300 protein binds to TGFBR2 promoter] and trichostatin A promotes the reaction [KAT2B protein binds to TGFBR2 promoter] CTD PMID:15647279 Tgfbr2 Rat trichostatin A increases expression ISO TGFBR2 (Homo sapiens) 6480464 trichostatin A results in increased expression of TGFBR2 mRNA and trichostatin A results in increased expression of TGFBR2 protein CTD PMID:15647279 Tgfbr2 Rat troglitazone decreases expression ISO TGFBR2 (Homo sapiens) 6480464 troglitazone results in decreased expression of TGFBR2 mRNA CTD PMID:25572481 Tgfbr2 Rat valproic acid increases expression ISO Tgfbr2 (Mus musculus) 6480464 Valproic Acid results in increased expression of TGFBR2 mRNA CTD PMID:24896083 Tgfbr2 Rat valsartan multiple interactions EXP 6480464 Valsartan inhibits the reaction [Carbon Tetrachloride results in increased expression of TGFBR2 mRNA] CTD PMID:16872305 Tgfbr2 Rat valsartan decreases expression EXP 6480464 Valsartan results in decreased expression of TGFBR2 mRNA CTD PMID:15619341 Tgfbr2 Rat vancomycin decreases expression ISO Tgfbr2 (Mus musculus) 6480464 Vancomycin results in decreased expression of TGFBR2 mRNA CTD PMID:18930951 Tgfbr2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of TGFBR2 mRNA CTD PMID:19015723
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (S)-amphetamine (ISO) (S)-nicotine (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-butoxyethanol (ISO) 2-nitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-nitrophenol (ISO) 4-vinylcyclohexene dioxide (ISO) 5-aza-2'-deoxycytidine (EXP,ISO) 6-propyl-2-thiouracil (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) 8-Br-cAMP (ISO) acetaldehyde (EXP) acetamide (EXP) acteoside (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP,ISO) all-trans-retinol (ISO) aluminium oxide (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) asbestos (ISO) avobenzone (ISO) azoxystrobin (ISO) bellidifolin (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) bisphenol F (ISO) bleomycin A2 (ISO) bromochloroacetic acid (EXP) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calciol (ISO) calcitriol (ISO) Candesartan cilexetil (EXP) cannabidiol (EXP) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) curcumin (EXP) cycloheximide (ISO) cyclophosphamide (EXP,ISO) cyclosporin A (EXP,ISO) cyproconazole (ISO) D-glucose (ISO) deguelin (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazepam (ISO) diethylstilbestrol (ISO) dimethylarsinic acid (EXP) dioxygen (ISO) diuron (EXP) doxorubicin (ISO) doxycycline (ISO) epoxiconazole (ISO) ethanol (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fructose (ISO) furosemide (EXP) galangin (ISO) genistein (EXP) gentamycin (EXP) glucose (ISO) glycyrrhizinic acid (ISO) glyphosate (ISO) hexachlorobenzene (ISO) hydrogen peroxide (ISO) indometacin (ISO) inulin (ISO) Isoangustone A (ISO) isobutanol (ISO) isoprenaline (ISO) isotretinoin (ISO) ketamine (ISO) ketoconazole (EXP) L-cysteine (EXP) L-methionine (EXP) lead(0) (ISO) leflunomide (ISO) lipopolysaccharide (EXP,ISO) lithium chloride (ISO) lithocholic acid (ISO) medroxyprogesterone acetate (ISO) menadione (ISO) methamphetamine (EXP,ISO) methapyrilene (ISO) methotrexate (ISO) methoxychlor (EXP) methyl beta-cyclodextrin (ISO) methylarsonic acid (EXP) Methylazoxymethanol acetate (EXP) methylmercury chloride (ISO) methylseleninic acid (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-acetyl-L-cysteine (EXP) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) N-Vinyl-2-pyrrolidone (EXP) nickel sulfate (ISO) nicotine (EXP) nitrofen (EXP) osthole (ISO) oxalic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) patulin (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) perindopril (EXP) phenobarbital (EXP,ISO) phenylephrine (EXP) picoxystrobin (ISO) pirinixic acid (EXP,ISO) platycodin D (ISO) potassium chromate (ISO) progesterone (ISO) propiconazole (ISO) prostaglandin E2 (ISO) quercetin (ISO) raloxifene (ISO) resveratrol (ISO) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP) salvianolic acid B (EXP) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) simvastatin (EXP,ISO) sodium arsenite (EXP,ISO) sodium fluoride (ISO) streptozocin (ISO) succimer (ISO) T-2 toxin (EXP) tacrolimus hydrate (EXP) testosterone (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) thiram (ISO) tipifarnib (EXP) tolfenamic acid (ISO) toluene 2,4-diisocyanate (ISO) torcetrapib (ISO) tranilast (EXP) trichostatin A (ISO) troglitazone (ISO) valproic acid (ISO) valsartan (EXP) vancomycin (ISO) vinclozolin (EXP)
Biological Process
activin receptor signaling pathway (IBA) animal organ morphogenesis (IMP) animal organ regeneration (IEP) aorta morphogenesis (IEA,ISO) aortic valve morphogenesis (IEA,ISO) apoptotic process (IEA,ISO) artery morphogenesis (IEA,ISO) atrioventricular valve morphogenesis (IEA,ISO) brain development (IEA,ISO) branching involved in blood vessel morphogenesis (IEA,ISO) bronchus development (IEA,ISO) bronchus morphogenesis (IEA,ISO) cardiac left ventricle morphogenesis (IEA,ISO) cartilage development (IEA,ISO) cell differentiation (IEA) cell proliferation involved in endocardial cushion morphogenesis (ISO) cell surface receptor protein serine/threonine kinase signaling pathway (IEA) cellular response to acetaldehyde (IEP) cellular response to growth factor stimulus (IBA) digestive tract development (IEP) embryo implantation (IEP) embryonic cranial skeleton morphogenesis (IEA,ISO) embryonic hemopoiesis (IEA,ISO) endocardial cushion fusion (IEA,ISO) epithelial to mesenchymal transition (IEA,ISO) gastrulation (IEA,ISO) growth plate cartilage chondrocyte growth (IEA,ISO) growth plate cartilage development (IEA,ISO) heart development (IBA,IEA,ISO) heart looping (IEA,ISO) in utero embryonic development (IEA,ISO) inferior endocardial cushion morphogenesis (IEA,ISO) Langerhans cell differentiation (IEA,ISO) lens development in camera-type eye (IEA,ISO) lens fiber cell apoptotic process (IEA,ISO) lung development (IEA,IEP,ISO) lung lobe morphogenesis (IEA,ISO) lung morphogenesis (IEA,ISO) mammary gland morphogenesis (IEA,ISO) membranous septum morphogenesis (IEA,ISO) miRNA transport (IEA,ISO) negative regulation of cardiac muscle cell proliferation (IMP) negative regulation of cell population proliferation (IGI,IMP) nervous system development (IBA) Notch signaling pathway (IEA,ISO) outflow tract morphogenesis (IEA,ISO) outflow tract septum morphogenesis (IEA,ISO) positive regulation of angiogenesis (IEA,ISO) positive regulation of B cell tolerance induction (IEA,ISO) positive regulation of CD4-positive, alpha-beta T cell proliferation (IEA,ISO) positive regulation of epithelial cell migration (IEA,ISO) positive regulation of epithelial to mesenchymal transition (IEA,ISO) positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation (IEA,ISO) positive regulation of mesenchymal cell proliferation (IEA,ISO) positive regulation of NK T cell differentiation (IEA,ISO) positive regulation of reactive oxygen species metabolic process (IEA,ISO) positive regulation of skeletal muscle tissue regeneration (IEP) positive regulation of SMAD protein signal transduction (IEA,ISO) positive regulation of smooth muscle cell proliferation (IMP) positive regulation of T cell tolerance induction (IEA,ISO) positive regulation of tolerance induction to self antigen (IEA,ISO) receptor-mediated endocytosis (IDA) regulation of cell population proliferation (IEA,ISO) regulation of gene expression (IEA,ISO) regulation of stem cell differentiation (IEA,ISO) regulation of stem cell proliferation (IEA,ISO) response to cholesterol (IEA,ISO) response to estrogen (IEP) response to glucose (IEP) response to hypoxia (IEP,TAS) response to mechanical stimulus (IEP) response to nutrient (IEP) response to steroid hormone (IEP) response to xenobiotic stimulus (IEA,ISO) roof of mouth development (IEA,ISO) secondary palate development (IEA,ISO) SMAD protein signal transduction (IEA,ISO) smoothened signaling pathway (IEA,ISO) superior endocardial cushion morphogenesis (ISO) trachea formation (IEA,ISO) trachea morphogenesis (IEA,ISO) transforming growth factor beta receptor signaling pathway (IEA,IMP,ISO,TAS) tricuspid valve morphogenesis (IEA,ISO) vasculogenesis (IEA,IEP,ISO) ventricular septum morphogenesis (IEA,ISO)
Cellular Component
activin receptor complex (IBA) caveola (IDA,IEA,ISO) cell surface (IDA) external side of plasma membrane (IEA,ISO) extracellular space (ISO) membrane (IEA,ISO) membrane raft (IDA,IEA,ISO) nuclear body (IEA,ISO) plasma membrane (IBA,IEA,ISO) receptor complex (IEA,ISO) transforming growth factor beta ligand-receptor complex (IEA,ISO)
Molecular Function
activin binding (IBA) activin receptor activity, type I (IBA) ATP binding (IEA) glycosaminoglycan binding (IEA,ISO) kinase activator activity (IEA,ISO) kinase activity (IEA) metal ion binding (IEA) mitogen-activated protein kinase kinase kinase binding (IPI) molecular adaptor activity (ISO) nucleotide binding (IEA) protein binding (IPI,ISO) protein homodimerization activity (TAS) protein kinase activity (IEA) protein serine/threonine kinase activity (IEA) protein-containing complex binding (TAS) signaling receptor activity (IEA) SMAD binding (IEA,ISO) transferase activity (IEA) transforming growth factor beta binding (IBA,IEA,ISO) transforming growth factor beta receptor activity (IBA,IEA,ISO) transforming growth factor beta receptor activity, type II (IEA,IMP,ISO,TAS) transmembrane receptor protein serine/threonine kinase activity (IEA,ISO) type I transforming growth factor beta receptor binding (IBA,IEA,ISO) type III transforming growth factor beta receptor binding (ISO)
1.
Molecular mechanisms of TGF beta receptor-triggered signaling cascades rapidly induced by the calcineurin inhibitors cyclosporin A and FK506.
Akool el-S, etal., J Immunol. 2008 Aug 15;181(4):2831-45.
2.
Neurogenic niche modulation by activated microglia: transforming growth factor beta increases neurogenesis in the adult dentate gyrus.
Battista D, etal., Eur J Neurosci. 2006 Jan;23(1):83-93.
3.
Comparison of expression of TGF-beta1, its receptors TGFbeta1R-I and TGFbeta1R-II in rat kidneys during chronic nephropathy induced by cyclosporine and tacrolimus.
Bing P, etal., Transplant Proc. 2006 Sep;38(7):2180-2.
4.
Down-modulation of lung immune responses by interleukin-10 and transforming growth factor beta (TGF-beta) and analysis of TGF-beta receptors I and II in active tuberculosis.
Bonecini-Almeida MG, etal., Infect Immun. 2004 May;72(5):2628-34.
5.
Prognostic significance of transforming growth factor beta receptor II in estrogen receptor-negative breast cancer patients.
Buck MB, etal., Clin Cancer Res. 2004 Jan 15;10(2):491-8.
6.
Acetaldehyde stimulates the activation of latent transforming growth factor-beta1 and induces expression of the type II receptor of the cytokine in rat cultured hepatic stellate cells.
Chen A Biochem J 2002 Dec 15;368(Pt 3):683-93.
7.
Cholesterol suppresses cellular TGF-beta responsiveness: implications in atherogenesis.
Chen CL, etal., J Cell Sci. 2007 Oct 15;120(Pt 20):3509-21. Epub 2007 Sep 18.
8.
Genomic profiling identifies alterations in TGFbeta signaling through loss of TGFbeta receptor expression in human renal cell carcinogenesis and progression.
Copland JA, etal., Oncogene. 2003 Sep 11;22(39):8053-62.
9.
Ontogenic expression of TGFbeta 1, 2, and 3 and its receptors in the rat gastric mucosa.
de Andrade Sa ER, etal., Dev Dyn. 2003 Jul;227(3):450-7.
10.
Bone marrow derived-mesenchymal stem cells downregulate IL17A dependent IL6/STAT3 signaling pathway in CCl4-induced rat liver fibrosis.
Farouk S, etal., PLoS One. 2018 Oct 22;13(10):e0206130. doi: 10.1371/journal.pone.0206130. eCollection 2018.
11.
Expression of transforming growth factor-beta receptors types II and III within various cells in the rat periodontium.
Gao J, etal., J Periodontal Res. 1999 Feb;34(2):113-22.
12.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
13.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
14.
Genetic alterations of the transforming growth factor beta receptor genes in pancreatic and biliary adenocarcinomas.
Goggins M, etal., Cancer Res. 1998 Dec 1;58(23):5329-32.
15.
Role of transforming growth factor-beta superfamily signaling pathways in human disease.
Gordon KJ and Blobe GC, Biochim Biophys Acta. 2008 Apr;1782(4):197-228. Epub 2008 Feb 11.
16.
[Detection of the expression of Smad4, transforming growth factor beta(1) and beta receptor II proteins in paraffin-embedded human pancreatic cancer tissues]
Gu L, etal., Zhonghua Bing Li Xue Za Zhi. 2001 Dec;30(6):439-42.
17.
[The expression of transforming growth factor beta1 and its I, II receptors in the development of rat embryo and embryonic lung]
Guo Q, etal., Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2007 Apr;23(4):317-9.
18.
Elevation of expression of Smads 2, 3, and 4, decorin and TGF-beta in the chronic phase of myocardial infarct scar healing.
Hao J, etal., J Mol Cell Cardiol. 1999 Mar;31(3):667-78.
19.
Dynamic expression patterns of transforming growth factor-beta(2) and transforming growth factor-beta receptors in experimental glomerulonephritis.
Hartner A, etal., J Mol Med. 2003 Jan;81(1):32-42. Epub 2002 Dec 14.
20.
Angiotensin converting enzyme inhibitor suppresses glomerular transforming growth factor beta receptor expression in experimental diabetes in rats.
Hill C, etal., Diabetologia 2001 Apr;44(4):495-500.
21.
Vascular proliferation and transforming growth factor-beta expression in pre- and early stage of diabetes mellitus in Otsuka Long-Evans Tokushima fatty rats.
Hosomi N, etal., Atherosclerosis. 2002 May;162(1):69-76.
22.
Aggressive pancreatic ductal adenocarcinoma in mice caused by pancreas-specific blockade of transforming growth factor-beta signaling in cooperation with active Kras expression.
Ijichi H, etal., Genes Dev. 2006 Nov 15;20(22):3147-60.
23.
Mammalian transforming growth factor-betas: Smad signaling and physio-pathological roles.
Javelaud D and Mauviel A, Int J Biochem Cell Biol. 2004 Jul;36(7):1161-5.
24.
Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
Jones S, etal., Science. 2008 Sep 26;321(5897):1801-6. Epub 2008 Sep 4.
25.
Transforming growth factor-beta 1, 2, 3 and receptor type I and II in diabetic foot ulcers.
Jude EB, etal., Diabet Med. 2002 Jun;19(6):440-7.
26.
Loss of activin receptor type 2 protein expression in microsatellite unstable colon cancers.
Jung B, etal., Gastroenterology. 2004 Mar;126(3):654-9.
27.
Effects of anti-TGF-beta type II receptor antibody on experimental glomerulonephritis.
Kasuga H, etal., Kidney Int. 2001 Nov;60(5):1745-55.
28.
Differential expression of transforming growth factor-beta type I and II receptors by pulmonary cells in bleomycin-induced lung injury: correlation with repair and fibrosis.
Khalil N, etal., Exp Lung Res. 2002 Apr-May;28(3):233-50.
29.
Estrogen induces apoptosis in a rat prostatic adenocarcinoma: association with an increased expression of TGF-beta 1 and its type-I and type-II receptors.
Landstrom M, etal., Int J Cancer. 1996 Aug 7;67(4):573-9.
30.
Effects of hypoxia on expression of transforming growth factor-beta1 and its receptors I and II in the amoeboid microglial cells and murine BV-2 cells.
Li JJ, etal., Neuroscience. 2008 Oct 15;156(3):662-72. Epub 2008 Aug 6.
31.
Gene expression of transforming growth factor-beta receptors types I and II in rat endometrium during the estrous cycle and early pregnancy.
Lin HY, etal., Life Sci. 2006 May 1;78(23):2669-75. Epub 2006 Jan 19.
32.
TGF-beta type II receptor in rat renal vascular development: localization to juxtaglomerular cells.
Liu A and Ballermann BJ, Kidney Int. 1998 Mar;53(3):716-25.
33.
Transforming growth factor beta2, but not beta1 and beta3, is critical for early rat lung branching.
Liu J, etal., Dev Dyn. 2000 Apr;217(4):343-60.
34.
A syndrome of altered cardiovascular, craniofacial, neurocognitive and skeletal development caused by mutations in TGFBR1 or TGFBR2.
Loeys BL, etal., Nat Genet. 2005 Mar;37(3):275-81. Epub 2005 Jan 30.
35.
Betaglycan can act as a dual modulator of TGF-beta access to signaling receptors: mapping of ligand binding and GAG attachment sites.
Lopez-Casillas F, etal., J Cell Biol. 1994 Feb;124(4):557-68.
36.
SMAD pathway mediation of BDNF and TGF beta 2 regulation of proliferation and differentiation of hippocampal granule neurons.
Lu J, etal., Development. 2005 Jul;132(14):3231-42. Epub 2005 Jun 15.
37.
In situ detection of TGF betas, TGF beta receptor II mRNA and telomerase activity in rat cholangiocarcinogenesis.
Lu JP, etal., World J Gastroenterol 2003 Mar;9(3):590-4.
38.
Genomic structure of the transforming growth factor beta type II receptor gene and its mutations in hereditary nonpolyposis colorectal cancers.
Lu SL, etal., Cancer Res. 1996 Oct 15;56(20):4595-8.
39.
Presence of two signaling TGF-beta receptors in human pancreatic cancer correlates with advanced tumor stage.
Lu Z, etal., Dig Dis Sci. 1997 Oct;42(10):2054-63.
40.
Frameshift mutational target gene analysis identifies similarities and differences in constitutional mismatch repair-deficiency and Lynch syndrome.
Maletzki C, etal., Mol Carcinog. 2017 Jul;56(7):1753-1764. doi: 10.1002/mc.22632. Epub 2017 Mar 30.
41.
Inactivation of the type II TGF-beta receptor in colon cancer cells with microsatellite instability.
Markowitz S, etal., Science. 1995 Jun 2;268(5215):1336-8.
42.
TGFbeta in Cancer.
Massagué J, Cell. 2008 Jul 25;134(2):215-30. doi: 10.1016/j.cell.2008.07.001.
43.
Expression and functional analysis of endoglin in isolated liver cells and its involvement in fibrogenic Smad signalling.
Meurer SK, etal., Cell Signal. 2011 Apr;23(4):683-99. doi: 10.1016/j.cellsig.2010.12.002. Epub 2010 Dec 10.
44.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
45.
Heterozygous TGFBR2 mutations in Marfan syndrome.
Mizuguchi T, etal., Nat Genet. 2004 Aug;36(8):855-60. Epub 2004 Jul 4.
46.
Effects of retinoids on the TGF-beta system and extracellular matrix in experimental glomerulonephritis.
Morath C, etal., J Am Soc Nephrol. 2001 Nov;12(11):2300-9.
47.
The effect of streptozotocin-induced diabetes on the rat seminal vesicle: A possible pathophysiological basis for disorders of ejaculation.
Morrison JF, etal., Ann N Y Acad Sci. 2006 Nov;1084:267-79.
48.
Dynamic expression of transforming growth factor-betas (TGF-beta) and their type I and type II receptors in the synovial tissue of arthritic rats.
Mussener A, etal., Clin Exp Immunol. 1997 Jan;107(1):112-9.
49.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
50.
Changes in TGF-beta receptors of rat hepatocytes during primary culture and liver regeneration: increased expression of TGF-beta receptors associated with increased sensitivity to TGF-beta-mediated growth inhibition.
Nishikawa Y, etal., J Cell Physiol. 1998 Sep;176(3):612-23.
51.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
52.
Combination gene therapy of HGF and truncated type II TGF-beta receptor for rat liver cirrhosis after partial hepatectomy.
Ozawa S, etal., Surgery. 2006 Apr;139(4):563-73.
53.
Mutations in transforming growth factor-beta receptor type II cause familial thoracic aortic aneurysms and dissections.
Pannu H, etal., Circulation. 2005 Jul 26;112(4):513-20. Epub 2005 Jul 18.
54.
Expressions of transforming growth factor (TGF)-beta1 and TGF-beta type II receptor and their relationship with apoptosis during chemical hepatocarcinogenesis in rats.
Park DY, etal., Hepatol Res. 2003 Nov;27(3):205-213.
55.
Effect of transforming growth factor beta-1 in endotoxin-induced uveitis.
Peng B, etal., Invest Ophthalmol Vis Sci. 1997 Jan;38(1):257-60.
56.
Significant expression of endoglin (CD105), TGFbeta-1 and TGFbeta R-2 in the atherosclerotic aorta: an immunohistological study.
Piao M and Tokunaga O, J Atheroscler Thromb. 2006 Apr;13(2):82-9.
57.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
58.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
59.
Soluble TGFbeta type II receptor gene therapy ameliorates acute radiation-induced pulmonary injury in rats.
Rabbani ZN, etal., Int J Radiat Oncol Biol Phys. 2003 Oct 1;57(2):563-72.
60.
GOA pipeline
RGD automated data pipeline
61.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
62.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
63.
TGF-beta receptor expression and binding in rat mesangial cells: modulation by glucose and cyclic mechanical strain.
Riser BL, etal., Kidney Int. 1999 Aug;56(2):428-39.
64.
Expression of cavernous transforming growth factor-beta1 and its type II receptor in patients with erectile dysfunction.
Ryu JK, etal., Int J Androl. 2004 Feb;27(1):42-9.
65.
The adaptive response of transforming growth factor-beta 2 and -beta RII in the overloaded, regenerating and denervated muscles of rats.
Sakuma K, etal., Acta Neuropathol (Berl). 2000 Feb;99(2):177-85.
66.
Dopamine, dopamine D2 receptor short isoform, transforming growth factor (TGF)-beta1, and TGF-beta type II receptor interact to inhibit the growth of pituitary lactotropes.
Sarkar DK, etal., Endocrinology. 2005 Oct;146(10):4179-88. Epub 2005 Jun 16.
67.
DNA microarray analysis of pulmonary fibrosis three months after exposure to paraquat in rats.
Satomi Y, etal., J Toxicol Sci. 2006 Oct;31(4):345-55.
68.
Inhibition of TGFbeta signaling potentiates the FGF-2-induced stimulation of cardiomyocyte DNA synthesis.
Sheikh F, etal., Cardiovasc Res. 2004 Dec 1;64(3):516-25.
69.
Albumin endocytosis in endothelial cells induces TGF-beta receptor II signaling.
Siddiqui SS, etal., Am J Physiol Lung Cell Mol Physiol. 2004 May;286(5):L1016-26. Epub 2004 Jan 16.
70.
Transforming growth factor beta signaling impairs Neu-induced mammary tumorigenesis while promoting pulmonary metastasis.
Siegel PM, etal., Proc Natl Acad Sci U S A 2003 Jul 8;100(14):8430-5. Epub 2003 Jun 13.
71.
Transforming growth factor beta type II receptor expression in gastric cancer: evidence for two independent subgroups.
Takeno S, etal., Anticancer Res. 2002 Jul-Aug;22(4):2247-52.
72.
A dominant negative mutation of transforming growth factor-beta receptor type II gene in microsatellite stable oesophageal carcinoma.
Tanaka S, etal., Br J Cancer. 2000 May;82(9):1557-60.
73.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
74.
Molecular characterization of rat transforming growth factor-beta type II receptor.
Tsuchida K, etal., Biochem Biophys Res Commun 1993 Mar 31;191(3):790-5.
75.
Regulation of TGF-beta ligand and receptor expression in neonatal rat lungs exposed to chronic hypoxia.
Vicencio AG, etal., J Appl Physiol 2002 Sep;93(3):1123-30.
76.
Enhanced expression of the type II transforming growth factor-beta receptor is associated with decreased survival in human pancreatic cancer.
Wagner M, etal., Pancreas. 1999 Nov;19(4):370-6.
77.
[Effects of salvianolic acid B on expressions of TGF-beta1 and its receptors in liver of rats with dimethylnitrosamine-induced hepatic fibrosis]
Wang XN, etal., Zhong Xi Yi Jie He Xue Bao. 2005 Jul;3(4):286-9.
78.
Inhibitory effects of tranilast on expression of transforming growth factor-beta isoforms and receptors in injured arteries.
Ward MR, etal., Atherosclerosis. 1998 Apr;137(2):267-75. doi: 10.1016/s0021-9150(97)00275-x.
79.
Immunohistochemical expression of FGF-2, PDGF-A, VEGF and TGF beta RII in the pancreas in the course of ischemia/reperfusion-induced acute pancreatitis.
Warzecha Z, etal., J Physiol Pharmacol. 2004 Dec;55(4):791-810.
80.
A direct interaction between TGFbeta activated kinase 1 and the TGFbeta type II receptor: implications for TGFbeta signalling and cardiac hypertrophy.
Watkins SJ, etal., Cardiovasc Res. 2006 Feb 1;69(2):432-9. Epub 2005 Dec 19.
81.
Expression of transforming growth factor-beta receptor type I and type II in rat ventral prostate and Dunning R3327 PAP adenocarcinoma in response to castration and oestrogen treatment.
Wikstrom P, etal., Urol Res. 1997;25(2):103-11.
82.
Cell-type-specific activation of PAK2 by transforming growth factor beta independent of Smad2 and Smad3.
Wilkes MC, etal., Mol Cell Biol. 2003 Dec;23(23):8878-89.
83.
Pancreatic cancer: molecular pathogenesis and new therapeutic targets.
Wong HH and Lemoine NR, Nat Rev Gastroenterol Hepatol. 2009 Jul;6(7):412-22. Epub 2009 Jun 9.
84.
Expression of TGF beta1 genes and their receptor types I, II, and III in low- and high-grade malignancy non-Hodgkin's lymphomas.
Woszczyk D, etal., Med Sci Monit. 2004 Jan;10(1):CR33-7.
85.
TGF-beta signaling alterations and susceptibility to colorectal cancer.
Xu Y and Pasche B, Hum Mol Genet. 2007 Apr 15;16 Spec No 1:R14-20.
86.
Role of PKC and TGF-beta receptor in glucose-induced proliferation of smooth muscle cells.
Yasuda Y, etal., Biochem Biophys Res Commun. 2001 Feb 16;281(1):71-7.
87.
The TGF-{beta}/Smad2,3 signalling axis is impaired in experimental pulmonary hypertension.
Zakrzewicz A, etal., Eur Respir J. 2007 Mar 28;.
88.
Transforming growth factor-beta(s) and their receptors in aging rat prostate.
Zhao H, etal., Biochem Biophys Res Commun. 2002 Jun 7;294(2):464-9.
89.
Expression of transforming growth factor-beta type II receptor in rat lung is regulated during development.
Zhao Y and Young SL, Am J Physiol. 1995 Sep;269(3 Pt 1):L419-26.
90.
TGF-beta receptor types I and II are differentially expressed during corneal epithelial wound repair.
Zieske JD, etal., Invest Ophthalmol Vis Sci. 2001 Jun;42(7):1465-71.
Tgfbr2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 124,672,677 - 124,761,741 (-) NCBI GRCr8 mRatBN7.2 8 115,794,537 - 115,883,615 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 115,794,537 - 115,883,228 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 121,401,503 - 121,487,689 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 119,600,574 - 119,686,750 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 117,443,698 - 117,530,245 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 124,310,288 - 124,399,345 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 124,312,754 - 124,399,494 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 123,585,765 - 123,671,209 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 120,593,595 - 120,680,453 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 120,613,331 - 120,700,190 (-) NCBI Celera 8 115,012,175 - 115,096,500 (-) NCBI Celera Cytogenetic Map 8 q32 NCBI
TGFBR2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 30,606,356 - 30,694,142 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 30,606,478 - 30,694,249 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 30,647,848 - 30,735,634 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 30,622,998 - 30,710,638 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 30,623,041 - 30,708,147 NCBI Celera 3 30,584,920 - 30,672,564 (+) NCBI Celera Cytogenetic Map 3 p24.1 NCBI HuRef 3 30,590,599 - 30,678,240 (+) NCBI HuRef CHM1_1 3 30,598,177 - 30,685,783 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 30,608,862 - 30,696,629 (+) NCBI T2T-CHM13v2.0
Tgfbr2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 115,916,763 - 116,004,431 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 115,913,361 - 116,004,428 (-) Ensembl GRCm39 Ensembl GRCm38 9 116,087,695 - 116,175,363 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 116,084,293 - 116,175,360 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 115,996,813 - 116,084,481 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 115,936,405 - 116,023,987 (-) NCBI MGSCv36 mm8 Celera 9 116,548,860 - 116,637,499 (-) NCBI Celera Cytogenetic Map 9 F3 NCBI cM Map 9 68.39 NCBI
Tgfbr2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955430 21,932,553 - 22,001,837 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955430 21,919,338 - 21,999,688 (+) NCBI ChiLan1.0 ChiLan1.0
TGFBR2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 30,595,399 - 30,683,103 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 30,600,475 - 30,687,834 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 30,536,187 - 30,623,653 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 30,854,071 - 30,941,378 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 30,854,460 - 30,938,856 (+) Ensembl panpan1.1 panPan2
TGFBR2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 13,886,869 - 13,946,480 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 13,889,000 - 13,977,636 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 13,869,985 - 13,959,686 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 14,182,445 - 14,272,114 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 14,182,447 - 14,272,161 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 13,979,792 - 14,069,422 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 14,125,731 - 14,215,435 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 14,144,194 - 14,234,152 (-) NCBI UU_Cfam_GSD_1.0
Tgfbr2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 188,186,107 - 188,270,859 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936473 21,324,658 - 21,409,430 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936473 21,324,669 - 21,409,430 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TGFBR2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 16,784,490 - 16,878,160 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 16,784,370 - 16,875,828 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 18,707,787 - 18,712,636 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TGFBR2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 75,112,903 - 75,200,263 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 75,112,561 - 75,197,711 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 48,399,611 - 48,486,893 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tgfbr2
.
Predicted Target Of
Count of predictions: 47 Count of miRNA genes: 36 Interacting mature miRNAs: 42 Transcripts: ENSRNOT00000037883 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 724539 Cm19 Cardiac mass QTL 19 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 8 100149864 120994388 Rat 1599689 Iddm24 Insulin dependent diabetes mellitus QTL 24 4.72 0.001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 8 112834440 118649220 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
D8Got214
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 115,876,703 - 115,876,983 (+) MAPPER mRatBN7.2 Rnor_6.0 8 124,392,370 - 124,392,649 NCBI Rnor6.0 Rnor_5.0 8 123,664,527 - 123,664,806 UniSTS Rnor5.0 RGSC_v3.4 8 120,673,910 - 120,674,190 RGD RGSC3.4 RGSC_v3.4 8 120,673,911 - 120,674,190 UniSTS RGSC3.4 RGSC_v3.1 8 120,693,647 - 120,693,927 RGD Celera 8 115,089,982 - 115,090,261 UniSTS RH 3.4 Map 8 1222.2 UniSTS RH 3.4 Map 8 1222.2 RGD RH 2.0 Map 8 979.3 RGD Cytogenetic Map 8 q32 UniSTS
AI715297
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 115,796,930 - 115,797,071 (+) MAPPER mRatBN7.2 Rnor_6.0 8 124,312,682 - 124,312,822 NCBI Rnor6.0 Rnor_5.0 8 123,585,618 - 123,585,758 UniSTS Rnor5.0 RGSC_v3.4 8 120,593,448 - 120,593,588 UniSTS RGSC3.4 Celera 8 115,012,028 - 115,012,168 UniSTS RH 3.4 Map 8 1230.2 UniSTS Cytogenetic Map 8 q32 UniSTS
This gene Tgfbr2 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000037883 ⟹ ENSRNOP00000035501
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 115,794,537 - 115,882,987 (-) Ensembl Rnor_6.0 Ensembl 8 124,312,754 - 124,399,494 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116107 ⟹ ENSRNOP00000093892
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 115,794,537 - 115,883,228 (-) Ensembl
RefSeq Acc Id:
NM_031132 ⟹ NP_112394
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 124,674,986 - 124,761,469 (-) NCBI mRatBN7.2 8 115,796,846 - 115,883,343 (-) NCBI Rnor_6.0 8 124,312,829 - 124,398,864 (-) NCBI Rnor_5.0 8 123,585,765 - 123,671,209 (-) NCBI RGSC_v3.4 8 120,593,595 - 120,680,453 (-) RGD Celera 8 115,012,175 - 115,096,500 (-) RGD
Sequence:
CGCGCGCGCACACGCTCGCCTGGGGGACGGAGCCCCAGCCTCCTGCGCAGCTCTCCTCGGCCGCCGGGGGCCTCCTCCGGGCCTCCGAGCTCCGGGGATCGCCGGCCACATCTGGCCCGCACCTCTGC
hide sequence
RefSeq Acc Id:
XM_008766690 ⟹ XP_008764912
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 124,672,677 - 124,761,741 (-) NCBI mRatBN7.2 8 115,794,537 - 115,883,615 (-) NCBI Rnor_6.0 8 124,310,288 - 124,399,345 (-) NCBI
Sequence:
GTTATTTTATTAGGGGAAACCACGTGTTCGGGACTCTGGAGCTACATTTCAGAGCTCCCTCCTG
hide sequence
RefSeq Acc Id:
NP_112394 ⟸ NM_031132
- Peptide Label:
precursor
- UniProtKB:
P38438 (UniProtKB/Swiss-Prot), D0VED2 (UniProtKB/TrEMBL)
- Sequence:
MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKR
hide sequence
RefSeq Acc Id:
XP_008764912 ⟸ XM_008766690
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QK15 (UniProtKB/TrEMBL)
- Sequence:
MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSDVGMETQRDISIHLSCNRTVHPLKHFNSDLMAG
hide sequence
Ensembl Acc Id:
ENSRNOP00000035501 ⟸ ENSRNOT00000037883
Ensembl Acc Id:
ENSRNOP00000093892 ⟸ ENSRNOT00000116107
RGD ID: 13696359 Promoter ID: EPDNEW_R6884 Type: initiation region Name: Tgfbr2_1 Description: transforming growth factor, beta receptor 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 124,398,828 - 124,398,888 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-03-13
Tgfbr2
transforming growth factor, beta receptor 2
Tgfbr2
transforming growth factor, beta receptor II
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-07-01
Tgfbr2T
transforming growth factor, beta receptor IIT
Tgfbr2
transforming growth factor, beta receptor II
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-07-01
Tgfbr2
transforming growth factor, beta receptor II
Tgfbr2T
transforming growth factor, beta receptor IIT
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-06-11
Tgfbr2T
transforming growth factor, beta receptor IIT
Tgfbr2
transforming growth factor, beta receptor II
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-06-11
Tgfbr2
transforming growth factor, beta receptor II
Tgfbr2T
transforming growth factor, beta receptor IIT
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Tgfbr2
transforming growth factor, beta receptor 2
Name updated
70584 APPROVED
2002-02-26
Tgfbr2
transforming growth factor, beta receptor II
Name updated to reflect Human and Mouse nomenclature
70292 APPROVED
Note Type
Note
Reference
gene_disease
may play a role in the development of diabetic nephrepathy
68928
gene_function
receptor for TGF-beta and a constitutively active serine threonine kinase
68928
gene_pathway
binding TGF-beta isoform leads to recruitment and phosphorylation of Tgfbr1, starting the signaling cascade to the nucleus through the Smad proteins
68928
gene_process
inhibits the synthesis of collagenases and stimulates tissue production of metalloproteinase inhibitors
68928
