Symbol:
Erbb3
Name:
erb-b2 receptor tyrosine kinase 3
RGD ID:
69323
Description:
Enables neuregulin binding activity and neuregulin receptor activity. Involved in several processes, including cellular response to mechanical stimulus; mammary gland involution; and positive regulation of D-glucose import. Located in neuronal cell body and postsynaptic membrane. Biomarker of amblyopia; chronic obstructive pulmonary disease; and median neuropathy. Human ortholog(s) of this gene implicated in lethal congenital contracture syndrome 2; lung adenocarcinoma; lung non-small cell carcinoma; and neuronal intestinal dysplasia type A. Orthologous to human ERBB3 (erb-b2 receptor tyrosine kinase 3); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; angiotensin II signaling pathway via AT2 receptor; calcium/calcium-mediated signaling pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
avian erythroblastosis oncogene B 3; c-erbB-3; c-erbB3; nuc-ErbB3; proto-oncogene-like protein c-ErbB-3; receptor tyrosine-protein kinase erbB-3; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3; v-erb-b2 erythroblastic leukemia viral oncogene homolog 3; v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 1,579,079 - 1,600,379 (-) NCBI GRCr8 mRatBN7.2 7 994,549 - 1,015,876 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 996,225 - 1,015,525 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 3,758,331 - 3,777,703 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 5,634,321 - 5,653,694 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 5,932,064 - 5,951,447 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 2,989,202 - 3,010,610 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 2,989,340 - 3,010,350 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 2,962,964 - 2,984,938 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 1,858,057 - 1,877,353 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 1,858,056 - 1,877,353 (-) NCBI Celera 7 866,587 - 885,873 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Erbb3 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ERBB3 mRNA] CTD PMID:31150632 Erbb3 Rat 1,2-dimethylhydrazine decreases expression ISO Erbb3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ERBB3 mRNA CTD PMID:22206623 Erbb3 Rat 17alpha-ethynylestradiol affects expression ISO Erbb3 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ERBB3 mRNA CTD PMID:17555576 Erbb3 Rat 17beta-estradiol affects expression ISO ERBB3 (Homo sapiens) 6480464 Estradiol affects the expression of ERBB3 mRNA CTD PMID:14699072 Erbb3 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ERBB3 mRNA CTD PMID:35192832 Erbb3 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of ERBB3 mRNA CTD PMID:32145629 Erbb3 Rat 17beta-estradiol multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of ERBB3 mRNA and EGF protein promotes the reaction [Estradiol results in decreased expression of ERBB3 mRNA] CTD PMID:24758408 and PMID:30165855 Erbb3 Rat 17beta-estradiol decreases expression ISO ERBB3 (Homo sapiens) 6480464 Estradiol results in decreased expression of ERBB3 mRNA CTD PMID:20106945 more ... Erbb3 Rat 17beta-estradiol increases expression ISO Erbb3 (Mus musculus) 6480464 Estradiol results in increased expression of ERBB3 mRNA CTD PMID:15289156 Erbb3 Rat 17beta-estradiol multiple interactions ISO Erbb3 (Mus musculus) 6480464 [ERBB2 protein co-treated with ERBB3 protein] results in increased susceptibility to Estradiol CTD PMID:19861407 Erbb3 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO ERBB3 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Erbb3 Rat 2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 Erbb3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Erbb3 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of ERBB3 mRNA more ... CTD PMID:21762485 more ... Erbb3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ERBB3 mRNA CTD PMID:34747641 Erbb3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Erbb3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ERBB3 mRNA CTD PMID:33956508 Erbb3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ERBB3 mRNA CTD PMID:32109520 Erbb3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO ERBB3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ERBB3 mRNA CTD PMID:30096437 Erbb3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ERBB3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ERBB3 mRNA CTD PMID:11162886 more ... Erbb3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Erbb3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ERBB3 mRNA CTD PMID:18796159 more ... Erbb3 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Erbb3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ERBB3 mRNA CTD PMID:26251327 Erbb3 Rat 3,4-methylenedioxymethamphetamine increases methylation ISO Erbb3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of ERBB3 promoter CTD PMID:26251327 Erbb3 Rat 4'-epidoxorubicin multiple interactions ISO ERBB3 (Homo sapiens) 6480464 ERBB3 protein affects the susceptibility to [Epirubicin co-treated with CMF regimen] CTD PMID:18768436 Erbb3 Rat 4,4'-sulfonyldiphenol increases expression ISO Erbb3 (Mus musculus) 6480464 bisphenol S results in increased expression of ERBB3 mRNA CTD PMID:30951980 Erbb3 Rat 4,4'-sulfonyldiphenol affects methylation ISO Erbb3 (Mus musculus) 6480464 bisphenol S affects the methylation of ERBB3 gene CTD PMID:31683443 Erbb3 Rat 4,4'-sulfonyldiphenol decreases expression ISO Erbb3 (Mus musculus) 6480464 bisphenol S results in decreased expression of ERBB3 mRNA CTD PMID:39298647 Erbb3 Rat 4-hydroxyphenyl retinamide increases expression ISO Erbb3 (Mus musculus) 6480464 Fenretinide results in increased expression of ERBB3 mRNA CTD PMID:28973697 Erbb3 Rat 5-fluorouracil multiple interactions ISO ERBB3 (Homo sapiens) 6480464 Fluorouracil promotes the reaction [Curcumin results in decreased expression of and results in decreased phosphorylation of and results in decreased activity of ERBB3 protein] and Fluorouracil results in decreased expression of and results in decreased phosphorylation of and results in decreased activity of ERBB3 protein CTD PMID:17918158 Erbb3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ERBB3 mRNA CTD PMID:24780913 and PMID:25825206 Erbb3 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ERBB3 mRNA CTD PMID:31881176 Erbb3 Rat afimoxifene multiple interactions ISO ERBB3 (Homo sapiens) 6480464 afimoxifene inhibits the reaction [beta-hexachlorocyclohexane promotes the reaction [ERBB2 protein binds to ERBB3 protein]] CTD PMID:12439862 Erbb3 Rat aflatoxin B1 affects expression ISO ERBB3 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of ERBB3 protein CTD PMID:20106945 Erbb3 Rat aflatoxin B1 increases methylation ISO ERBB3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ERBB3 intron CTD PMID:30157460 Erbb3 Rat aflatoxin B1 decreases expression ISO ERBB3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ERBB3 mRNA CTD PMID:27153756 Erbb3 Rat aldehydo-D-glucose multiple interactions EXP 6480464 [NRG1 protein binds to ERBB3 protein] which results in increased transport of Glucose CTD PMID:14711829 Erbb3 Rat aldrin multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 Erbb3 Rat all-trans-retinoic acid multiple interactions ISO Erbb3 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of ERBB3 mRNA and [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of ERBB3 mRNA CTD PMID:30951980 and PMID:36189433 Erbb3 Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in increased expression of ERBB3 protein CTD PMID:34896426 Erbb3 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ERBB3 mRNA CTD PMID:35163327 Erbb3 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of ERBB3 mRNA CTD PMID:30779732 Erbb3 Rat androgen antagonist multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat antimycin A increases expression ISO ERBB3 (Homo sapiens) 6480464 Antimycin A results in increased expression of ERBB3 mRNA CTD PMID:33512557 Erbb3 Rat antirheumatic drug increases expression ISO ERBB3 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of ERBB3 mRNA CTD PMID:24449571 Erbb3 Rat arsane multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERBB3 mRNA more ... CTD PMID:32525701 and PMID:39836092 Erbb3 Rat arsenic atom multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERBB3 mRNA more ... CTD PMID:32525701 and PMID:39836092 Erbb3 Rat arsenite(3-) decreases expression ISO ERBB3 (Homo sapiens) 6480464 arsenite results in decreased expression of ERBB3 mRNA CTD PMID:31646340 Erbb3 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of ERBB3 mRNA CTD PMID:36841081 Erbb3 Rat Azoxymethane multiple interactions ISO Erbb3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ERBB3 mRNA CTD PMID:29950665 Erbb3 Rat benzo[a]pyrene decreases expression ISO ERBB3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ERBB3 mRNA CTD PMID:20106945 and PMID:32234424 Erbb3 Rat benzo[a]pyrene increases expression ISO Erbb3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ERBB3 mRNA CTD PMID:19770486 Erbb3 Rat beta-hexachlorocyclohexane multiple interactions ISO ERBB3 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one promotes the reaction [beta-hexachlorocyclohexane promotes the reaction [ERBB2 protein binds to ERBB3 protein]] more ... CTD PMID:12439862 Erbb3 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Erbb3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ERBB3 mRNA CTD PMID:33162236 Erbb3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ERBB3 protein CTD PMID:19590682 Erbb3 Rat bisphenol A affects methylation ISO ERBB3 (Homo sapiens) 6480464 bisphenol A affects the methylation of ERBB3 gene CTD PMID:31601247 Erbb3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ERBB3 mRNA CTD PMID:32145629 Erbb3 Rat bisphenol A increases expression ISO Erbb3 (Mus musculus) 6480464 bisphenol A results in increased expression of ERBB3 mRNA and bisphenol A results in increased expression of ERBB3 protein CTD PMID:30951980 more ... Erbb3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ERBB3 mRNA CTD PMID:25181051 and PMID:34947998 Erbb3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ERBB3 mRNA and [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat bisphenol A increases expression ISO ERBB3 (Homo sapiens) 6480464 bisphenol A results in increased expression of ERBB3 mRNA CTD PMID:22576693 Erbb3 Rat bisphenol A increases phosphorylation ISO Erbb3 (Mus musculus) 6480464 bisphenol A results in increased phosphorylation of ERBB3 protein CTD PMID:21988766 Erbb3 Rat bisphenol A decreases expression ISO ERBB3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ERBB3 mRNA CTD PMID:16029874 Erbb3 Rat bisphenol AF multiple interactions ISO ERBB3 (Homo sapiens) 6480464 AREG protein affects the reaction [bisphenol AF results in increased expression of and results in increased phosphorylation of ERBB3 protein] more ... CTD PMID:31059536 Erbb3 Rat bisphenol F multiple interactions ISO Erbb3 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of ERBB3 mRNA CTD PMID:30951980 Erbb3 Rat bisphenol F increases expression ISO Erbb3 (Mus musculus) 6480464 bisphenol F results in increased expression of ERBB3 mRNA CTD PMID:30951980 and PMID:38685157 Erbb3 Rat butanal decreases expression ISO ERBB3 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ERBB3 mRNA CTD PMID:26079696 Erbb3 Rat Butylparaben multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ERBB3 mRNA and [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat butyric acid increases expression ISO ERBB3 (Homo sapiens) 6480464 Butyric Acid results in increased expression of ERBB3 mRNA CTD PMID:34581912 Erbb3 Rat cadmium atom decreases expression ISO ERBB3 (Homo sapiens) 6480464 Cadmium results in decreased expression of ERBB3 mRNA CTD PMID:31646340 Erbb3 Rat cadmium dichloride multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of ERBB3 mRNA CTD PMID:12634122 Erbb3 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ERBB3 mRNA CTD PMID:33453195 Erbb3 Rat caffeine affects phosphorylation ISO ERBB3 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of ERBB3 protein CTD PMID:35688186 Erbb3 Rat calcitriol increases expression ISO ERBB3 (Homo sapiens) 6480464 Calcitriol results in increased expression of ERBB3 mRNA CTD PMID:26485663 Erbb3 Rat capecitabine increases response to substance ISO ERBB3 (Homo sapiens) 6480464 ERBB3 protein results in increased susceptibility to Capecitabine CTD PMID:16734730 Erbb3 Rat captan decreases expression ISO Erbb3 (Mus musculus) 6480464 Captan results in decreased expression of ERBB3 mRNA CTD PMID:31558096 Erbb3 Rat carbamazepine affects expression ISO ERBB3 (Homo sapiens) 6480464 Carbamazepine affects the expression of ERBB3 mRNA CTD PMID:25979313 Erbb3 Rat casticin increases expression ISO ERBB3 (Homo sapiens) 6480464 casticin results in increased expression of ERBB3 mRNA CTD PMID:27862857 Erbb3 Rat chloroquine decreases expression ISO ERBB3 (Homo sapiens) 6480464 Chloroquine results in decreased expression of ERBB3 protein CTD PMID:20332299 Erbb3 Rat chlorpyrifos decreases expression ISO Erbb3 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of ERBB3 mRNA CTD PMID:37019170 Erbb3 Rat choline multiple interactions ISO Erbb3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of ERBB3 mRNA CTD PMID:20938992 Erbb3 Rat chromium(6+) affects expression ISO ERBB3 (Homo sapiens) 6480464 chromium hexavalent ion affects the expression of ERBB3 mRNA CTD PMID:18053681 Erbb3 Rat clothianidin increases expression ISO ERBB3 (Homo sapiens) 6480464 clothianidin results in increased expression of ERBB3 mRNA CTD PMID:31626844 Erbb3 Rat copper atom multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of ERBB3 mRNA CTD PMID:20971185 Erbb3 Rat copper(0) multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of ERBB3 mRNA CTD PMID:20971185 Erbb3 Rat copper(II) sulfate decreases expression ISO ERBB3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ERBB3 mRNA CTD PMID:19549813 Erbb3 Rat coumestrol decreases expression ISO ERBB3 (Homo sapiens) 6480464 Coumestrol results in decreased expression of ERBB3 mRNA CTD PMID:19167446 Erbb3 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ERBB3 mRNA CTD PMID:27523638 Erbb3 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of ERBB3 mRNA CTD PMID:26577399 Erbb3 Rat curcumin multiple interactions ISO ERBB3 (Homo sapiens) 6480464 Curcumin promotes the reaction [Folfox protocol results in decreased expression of and results in decreased phosphorylation of and results in decreased activity of ERBB3 protein] more ... CTD PMID:17918158 Erbb3 Rat curcumin decreases expression ISO ERBB3 (Homo sapiens) 6480464 Curcumin analog results in decreased expression of ERBB3 mRNA and Curcumin results in decreased expression of ERBB3 mRNA CTD PMID:15713895 and PMID:26409325 Erbb3 Rat cycloheximide decreases expression ISO ERBB3 (Homo sapiens) 6480464 Cycloheximide results in decreased expression of ERBB3 mRNA CTD PMID:15228094 Erbb3 Rat cyclosporin A decreases expression ISO ERBB3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ERBB3 mRNA CTD PMID:20106945 more ... Erbb3 Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in increased expression of ERBB3 protein CTD PMID:34896426 Erbb3 Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in increased expression of ERBB3 protein CTD PMID:34896426 Erbb3 Rat D-glucose multiple interactions EXP 6480464 [NRG1 protein binds to ERBB3 protein] which results in increased transport of Glucose CTD PMID:14711829 Erbb3 Rat daunorubicin decreases expression ISO ERBB3 (Homo sapiens) 6480464 Daunorubicin results in decreased expression of ERBB3 mRNA CTD PMID:26537877 and PMID:28940058 Erbb3 Rat DDD multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 Erbb3 Rat DDE multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 Erbb3 Rat DDE multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat dexamethasone increases expression ISO Erbb3 (Mus musculus) 6480464 Dexamethasone results in increased expression of ERBB3 mRNA CTD PMID:21041162 Erbb3 Rat dextran sulfate multiple interactions ISO Erbb3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ERBB3 mRNA CTD PMID:29950665 Erbb3 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of ERBB3 mRNA CTD PMID:22546817 Erbb3 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ERBB3 mRNA CTD PMID:21266533 Erbb3 Rat dibutyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat dichromium trioxide multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of ERBB3 mRNA CTD PMID:12634122 Erbb3 Rat dieldrin multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 Erbb3 Rat diethylstilbestrol increases expression ISO Erbb3 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of ERBB3 mRNA CTD PMID:15289156 Erbb3 Rat dioxygen multiple interactions ISO Erbb3 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ERBB3 mRNA CTD PMID:30529165 Erbb3 Rat dorsomorphin multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Erbb3 Rat doxifluridine increases response to substance ISO ERBB3 (Homo sapiens) 6480464 ERBB3 protein results in increased susceptibility to doxifluridine CTD PMID:16734730 Erbb3 Rat doxorubicin affects response to substance ISO ERBB3 (Homo sapiens) 6480464 ERBB3 protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Erbb3 Rat doxorubicin decreases expression ISO ERBB3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ERBB3 mRNA CTD PMID:26537877 more ... Erbb3 Rat doxorubicin multiple interactions ISO ERBB3 (Homo sapiens) 6480464 ERBB3 protein inhibits the reaction [Doxorubicin results in decreased phosphorylation of AKT1 protein] CTD PMID:16168102 Erbb3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ERBB3 mRNA CTD PMID:29391264 Erbb3 Rat entinostat multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ERBB3 mRNA CTD PMID:27188386 Erbb3 Rat entinostat increases expression ISO ERBB3 (Homo sapiens) 6480464 entinostat results in increased expression of ERBB3 mRNA CTD PMID:26272509 Erbb3 Rat enzacamene multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ERBB3 mRNA and [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat epoxiconazole multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat erlotinib hydrochloride decreases response to substance ISO ERBB3 (Homo sapiens) 6480464 ERBB3 mRNA results in decreased susceptibility to Erlotinib Hydrochloride CTD PMID:23125191 Erbb3 Rat ethanol affects expression ISO Erbb3 (Mus musculus) 6480464 Ethanol affects the expression of ERBB3 mRNA CTD PMID:30319688 Erbb3 Rat etoposide affects response to substance ISO ERBB3 (Homo sapiens) 6480464 ERBB3 protein affects the susceptibility to Etoposide CTD PMID:16217747 Erbb3 Rat etoposide decreases expression ISO ERBB3 (Homo sapiens) 6480464 Etoposide results in decreased expression of ERBB3 mRNA CTD PMID:15228094 and PMID:29397400 Erbb3 Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in increased expression of ERBB3 protein CTD PMID:34896426 Erbb3 Rat fisetin decreases expression ISO ERBB3 (Homo sapiens) 6480464 fisetin results in decreased expression of ERBB3 protein CTD PMID:30431692 Erbb3 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of ERBB3 mRNA CTD PMID:24136188 Erbb3 Rat folic acid multiple interactions ISO Erbb3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of ERBB3 mRNA CTD PMID:20938992 Erbb3 Rat folpet affects expression ISO Erbb3 (Mus musculus) 6480464 folpet affects the expression of ERBB3 mRNA CTD PMID:31558096 Erbb3 Rat FR900359 affects phosphorylation ISO ERBB3 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of ERBB3 protein CTD PMID:37730182 Erbb3 Rat fulvestrant multiple interactions ISO ERBB3 (Homo sapiens) 6480464 Fulvestrant inhibits the reaction [bisphenol AF results in increased expression of and results in increased phosphorylation of ERBB3 protein] CTD PMID:31059536 Erbb3 Rat fulvestrant decreases expression ISO ERBB3 (Homo sapiens) 6480464 Fulvestrant results in decreased expression of ERBB3 mRNA CTD PMID:31646340 Erbb3 Rat genistein increases expression ISO Erbb3 (Mus musculus) 6480464 Genistein results in increased expression of ERBB3 mRNA CTD PMID:15289156 Erbb3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ERBB3 mRNA CTD PMID:33387578 Erbb3 Rat glucose multiple interactions EXP 6480464 [NRG1 protein binds to ERBB3 protein] which results in increased transport of Glucose CTD PMID:14711829 Erbb3 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of ERBB3 mRNA CTD PMID:24395379 Erbb3 Rat hydrogen sulfide decreases expression ISO Erbb3 (Mus musculus) 6480464 Hydrogen Sulfide results in decreased expression of ERBB3 mRNA CTD PMID:31843631 Erbb3 Rat L-methionine multiple interactions ISO Erbb3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of ERBB3 mRNA CTD PMID:20938992 Erbb3 Rat lapatinib decreases expression ISO ERBB3 (Homo sapiens) 6480464 lapatinib results in decreased expression of ERBB3 protein modified form CTD PMID:19435893 Erbb3 Rat lapatinib decreases activity ISO ERBB3 (Homo sapiens) 6480464 lapatinib results in decreased activity of ERBB3 protein CTD PMID:19509167 Erbb3 Rat lead diacetate multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of ERBB3 mRNA CTD PMID:12634122 Erbb3 Rat linuron multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat lithium chloride increases expression ISO ERBB3 (Homo sapiens) 6480464 Lithium Chloride results in increased expression of ERBB3 mRNA CTD PMID:23527032 Erbb3 Rat LY294002 multiple interactions ISO ERBB3 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one promotes the reaction [beta-hexachlorocyclohexane promotes the reaction [ERBB2 protein binds to ERBB3 protein]] CTD PMID:12439862 Erbb3 Rat manganese atom multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERBB3 mRNA CTD PMID:39836092 Erbb3 Rat manganese(0) multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERBB3 mRNA CTD PMID:39836092 Erbb3 Rat manganese(II) chloride multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERBB3 mRNA CTD PMID:39836092 Erbb3 Rat menadione affects expression ISO ERBB3 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of ERBB3 mRNA CTD PMID:20044591 Erbb3 Rat metformin decreases expression EXP 6480464 Metformin results in decreased expression of ERBB3 mRNA CTD PMID:31324951 Erbb3 Rat mitomycin C affects response to substance ISO ERBB3 (Homo sapiens) 6480464 ERBB3 protein affects the susceptibility to Mitomycin CTD PMID:16217747 Erbb3 Rat mitoxantrone decreases expression ISO ERBB3 (Homo sapiens) 6480464 Mitoxantrone results in decreased expression of ERBB3 mRNA CTD PMID:26537877 and PMID:28940058 Erbb3 Rat mono(2-ethylhexyl) phthalate decreases expression ISO ERBB3 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of ERBB3 mRNA CTD PMID:36695872 Erbb3 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Erbb3 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of ERBB3 mRNA CTD PMID:36189433 Erbb3 Rat monosodium L-glutamate increases expression ISO Erbb3 (Mus musculus) 6480464 Sodium Glutamate results in increased expression of ERBB3 mRNA CTD PMID:19001666 Erbb3 Rat monosodium L-glutamate multiple interactions ISO Erbb3 (Mus musculus) 6480464 [Sodium Glutamate co-treated with Trans Fatty Acids] results in decreased expression of ERBB3 mRNA CTD PMID:19001666 Erbb3 Rat N-acetylcysteamine decreases phosphorylation ISO ERBB3 (Homo sapiens) 6480464 2-acetamidoethanethiol analog results in decreased phosphorylation of ERBB3 protein CTD PMID:20058253 Erbb3 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO ERBB3 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of ERBB3 protein CTD PMID:20332299 Erbb3 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO ERBB3 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [sulindac sulfide results in decreased expression of ERBB3 protein] and benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [sulindac sulfone results in decreased expression of ERBB3 protein] CTD PMID:20332299 Erbb3 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of ERBB3 mRNA CTD PMID:22546817 Erbb3 Rat nickel sulfate decreases expression ISO ERBB3 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of ERBB3 mRNA CTD PMID:18651567 Erbb3 Rat paclitaxel decreases response to substance ISO ERBB3 (Homo sapiens) 6480464 ERBB3 protein results in decreased susceptibility to Paclitaxel CTD PMID:16734730 Erbb3 Rat panobinostat increases expression ISO ERBB3 (Homo sapiens) 6480464 panobinostat results in increased expression of ERBB3 mRNA CTD PMID:26272509 Erbb3 Rat panobinostat multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ERBB3 mRNA CTD PMID:27188386 Erbb3 Rat paracetamol increases expression ISO Erbb3 (Mus musculus) 6480464 Acetaminophen results in increased expression of ERBB3 mRNA CTD PMID:17585979 Erbb3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ERBB3 mRNA CTD PMID:33387578 Erbb3 Rat paracetamol decreases expression ISO Erbb3 (Mus musculus) 6480464 Acetaminophen results in decreased expression of ERBB3 mRNA CTD PMID:29246445 Erbb3 Rat paracetamol multiple interactions ISO Erbb3 (Mus musculus) 6480464 PANX1 gene mutant form promotes the reaction [Acetaminophen results in decreased expression of ERBB3 mRNA] and YAP1 gene mutant form promotes the reaction [Acetaminophen results in increased expression of ERBB3 mRNA] CTD PMID:29246445 and PMID:34546377 Erbb3 Rat paracetamol multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat paracetamol decreases expression ISO ERBB3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ERBB3 mRNA CTD PMID:21420995 Erbb3 Rat paraquat decreases expression ISO Erbb3 (Mus musculus) 6480464 Paraquat results in decreased expression of ERBB3 mRNA CTD PMID:16797015 and PMID:21463325 Erbb3 Rat perfluorononanoic acid decreases expression ISO ERBB3 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of ERBB3 mRNA CTD PMID:32588087 Erbb3 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ERBB3 mRNA CTD PMID:35163327 Erbb3 Rat perfluorooctanoic acid decreases expression ISO ERBB3 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of ERBB3 protein CTD PMID:26879310 Erbb3 Rat pirinixic acid decreases expression ISO Erbb3 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ERBB3 mRNA CTD PMID:18445702 Erbb3 Rat prochloraz multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat procymidone multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat pyrethrins increases expression EXP 6480464 Pyrethrins results in increased expression of ERBB3 protein CTD PMID:34896426 Erbb3 Rat quercetin decreases expression ISO ERBB3 (Homo sapiens) 6480464 Quercetin results in decreased expression of ERBB3 mRNA and Quercetin results in decreased expression of ERBB3 protein CTD PMID:15741050 more ... Erbb3 Rat quercetin multiple interactions ISO ERBB3 (Homo sapiens) 6480464 Quercetin inhibits the reaction [EGF protein results in increased phosphorylation of ERBB3 protein] more ... CTD PMID:12888923 Erbb3 Rat raloxifene affects expression ISO ERBB3 (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of ERBB3 mRNA CTD PMID:14699072 Erbb3 Rat resveratrol decreases expression ISO ERBB3 (Homo sapiens) 6480464 resveratrol results in decreased expression of ERBB3 mRNA CTD PMID:19371625 Erbb3 Rat SB 431542 multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Erbb3 Rat silicon dioxide decreases expression ISO ERBB3 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of ERBB3 mRNA CTD PMID:25895662 Erbb3 Rat silver atom decreases expression ISO ERBB3 (Homo sapiens) 6480464 Silver results in decreased expression of ERBB3 mRNA CTD PMID:26014281 and PMID:26551752 Erbb3 Rat silver(0) decreases expression ISO ERBB3 (Homo sapiens) 6480464 Silver results in decreased expression of ERBB3 mRNA CTD PMID:26014281 and PMID:26551752 Erbb3 Rat sodium arsenate multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of ERBB3 mRNA CTD PMID:32525701 Erbb3 Rat sodium arsenite multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERBB3 mRNA more ... CTD PMID:12634122 and PMID:39836092 Erbb3 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ERBB3 mRNA CTD PMID:11241755 Erbb3 Rat sodium arsenite decreases expression ISO ERBB3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ERBB3 mRNA CTD PMID:25879800 more ... Erbb3 Rat sodium dichromate increases expression ISO Erbb3 (Mus musculus) 6480464 sodium bichromate results in increased expression of ERBB3 mRNA CTD PMID:31558096 Erbb3 Rat sulindac sulfide multiple interactions ISO ERBB3 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [sulindac sulfide results in decreased expression of ERBB3 protein] CTD PMID:20332299 Erbb3 Rat sulindac sulfide decreases expression ISO ERBB3 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of ERBB3 protein CTD PMID:20332299 Erbb3 Rat sulindac sulfone multiple interactions ISO ERBB3 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [sulindac sulfone results in decreased expression of ERBB3 protein] CTD PMID:20332299 Erbb3 Rat sulindac sulfone decreases expression ISO ERBB3 (Homo sapiens) 6480464 sulindac sulfone results in decreased expression of ERBB3 protein CTD PMID:20332299 Erbb3 Rat sunitinib decreases expression ISO ERBB3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ERBB3 mRNA CTD PMID:31533062 Erbb3 Rat tamoxifen decreases response to substance ISO ERBB3 (Homo sapiens) 6480464 ERBB3 protein results in decreased susceptibility to Tamoxifen CTD PMID:16000581 Erbb3 Rat tamoxifen affects expression ISO Erbb3 (Mus musculus) 6480464 Tamoxifen affects the expression of ERBB3 mRNA CTD PMID:17555576 Erbb3 Rat tephrosin multiple interactions ISO ERBB3 (Homo sapiens) 6480464 tephrosin inhibits the reaction [NRG1 protein affects the phosphorylation of ERBB3 protein] and tephrosin results in increased degradation of and results in decreased phosphorylation of ERBB3 protein CTD PMID:20056314 Erbb3 Rat tetrachloroethene increases expression ISO Erbb3 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of ERBB3 mRNA CTD PMID:28973375 Erbb3 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ERBB3 mRNA CTD PMID:31150632 Erbb3 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ERBB3 mRNA] CTD PMID:31150632 Erbb3 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ERBB3 mRNA CTD PMID:34492290 Erbb3 Rat titanium dioxide multiple interactions ISO Erbb3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ERBB3 mRNA CTD PMID:29950665 Erbb3 Rat topotecan affects response to substance ISO ERBB3 (Homo sapiens) 6480464 ERBB3 protein affects the susceptibility to Topotecan CTD PMID:16217747 Erbb3 Rat trichloroethene multiple interactions ISO Erbb3 (Mus musculus) 6480464 PPARA protein inhibits the reaction [Trichloroethylene results in decreased expression of ERBB3 mRNA] CTD PMID:15363585 Erbb3 Rat trichostatin A increases expression ISO ERBB3 (Homo sapiens) 6480464 trichostatin A results in increased expression of ERBB3 mRNA CTD PMID:24935251 and PMID:26272509 Erbb3 Rat trichostatin A affects expression ISO ERBB3 (Homo sapiens) 6480464 trichostatin A affects the expression of ERBB3 mRNA CTD PMID:28542535 Erbb3 Rat trichostatin A multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ERBB3 mRNA CTD PMID:27188386 Erbb3 Rat troglitazone decreases expression ISO Erbb3 (Mus musculus) 6480464 troglitazone results in decreased expression of ERBB3 mRNA CTD PMID:28973697 Erbb3 Rat tunicamycin decreases expression ISO Erbb3 (Mus musculus) 6480464 Tunicamycin results in decreased expression of ERBB3 mRNA CTD PMID:17127020 Erbb3 Rat uranium atom affects expression ISO ERBB3 (Homo sapiens) 6480464 Uranium affects the expression of ERBB3 mRNA CTD PMID:15672453 Erbb3 Rat valproic acid affects expression ISO ERBB3 (Homo sapiens) 6480464 Valproic Acid affects the expression of ERBB3 mRNA CTD PMID:25979313 Erbb3 Rat valproic acid decreases expression ISO ERBB3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ERBB3 mRNA CTD PMID:28001369 and PMID:29154799 Erbb3 Rat valproic acid multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ERBB3 mRNA CTD PMID:27188386 Erbb3 Rat valproic acid increases expression ISO ERBB3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ERBB3 mRNA CTD PMID:19101580 more ... Erbb3 Rat valproic acid increases expression ISO Erbb3 (Mus musculus) 6480464 Valproic Acid results in increased expression of ERBB3 mRNA CTD PMID:24896083 Erbb3 Rat vinclozolin multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ERBB3 mRNA CTD PMID:25607892 Erbb3 Rat vorinostat multiple interactions ISO ERBB3 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ERBB3 mRNA CTD PMID:27188386 Erbb3 Rat vorinostat increases expression ISO ERBB3 (Homo sapiens) 6480464 vorinostat results in increased expression of ERBB3 mRNA CTD PMID:26272509 Erbb3 Rat zearalenone decreases expression ISO ERBB3 (Homo sapiens) 6480464 Zearalenone results in decreased expression of ERBB3 mRNA CTD PMID:19371625
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4'-epidoxorubicin (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (EXP) aldrin (ISO) all-trans-retinoic acid (ISO) allethrin (EXP) alpha-Zearalanol (EXP) amphetamine (EXP) androgen antagonist (EXP) antimycin A (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (EXP) Azoxymethane (ISO) benzo[a]pyrene (ISO) beta-hexachlorocyclohexane (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) butanal (ISO) Butylparaben (EXP) butyric acid (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) capecitabine (ISO) captan (ISO) carbamazepine (ISO) casticin (ISO) chloroquine (ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) clothianidin (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumestrol (ISO) Cuprizon (EXP) curcumin (ISO) cycloheximide (ISO) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) D-glucose (EXP) daunorubicin (ISO) DDD (ISO) DDE (EXP,ISO) dexamethasone (ISO) dextran sulfate (ISO) diazinon (EXP) dibutyl phthalate (EXP) dichromium trioxide (ISO) dieldrin (ISO) diethylstilbestrol (ISO) dioxygen (ISO) dorsomorphin (ISO) doxifluridine (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) enzacamene (EXP) epoxiconazole (EXP) erlotinib hydrochloride (ISO) ethanol (ISO) etoposide (ISO) fenvalerate (EXP) fisetin (ISO) flutamide (EXP) folic acid (ISO) folpet (ISO) FR900359 (ISO) fulvestrant (ISO) genistein (ISO) gentamycin (EXP) glucose (EXP) glycidol (EXP) hydrogen sulfide (ISO) L-methionine (ISO) lapatinib (ISO) lead diacetate (ISO) linuron (EXP) lithium chloride (ISO) LY294002 (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) metformin (EXP) mitomycin C (ISO) mitoxantrone (ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (ISO) N-acetylcysteamine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel dichloride (EXP) nickel sulfate (ISO) paclitaxel (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorononanoic acid (ISO) perfluorooctanoic acid (EXP,ISO) pirinixic acid (ISO) prochloraz (EXP) procymidone (EXP) pyrethrins (EXP) quercetin (ISO) raloxifene (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium dichromate (ISO) sulindac sulfide (ISO) sulindac sulfone (ISO) sunitinib (ISO) tamoxifen (ISO) tephrosin (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (ISO) trichloroethene (ISO) trichostatin A (ISO) troglitazone (ISO) tunicamycin (ISO) uranium atom (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO) zearalenone (ISO)
1.
Gene expression profiling of ERBB receptors and ligands in human transitional cell carcinoma of the bladder.
Amsellem-Ouazana D, etal., J Urol. 2006 Mar;175(3 Pt 1):1127-32.
2.
ErbB receptors modulation in different types of peripheral nerve regeneration.
Audisio C, etal., Neuroreport. 2008 Oct 29;19(16):1605-9. doi: 10.1097/WNR.0b013e32831313ef.
3.
Prognostic implications of altered human epidermal growth factor receptors (HERs) in gastric carcinomas: HER2 and HER3 are predictors of poor outcome.
Begnami MD, etal., J Clin Oncol. 2011 Aug 1;29(22):3030-6. doi: 10.1200/JCO.2010.33.6313. Epub 2011 Jun 27.
4.
c-erbB-3 protein expression in ductal carcinoma in situ of the breast.
Bobrow LG, etal., Eur J Cancer. 1997 Oct;33(11):1846-50.
5.
Immunohistochemical expression patterns of the HER4 receptors in normal mucosa and in laryngeal squamous cell carcinomas: antioncogenic significance of the HER4 protein in laryngeal squamous cell carcinoma.
Bussu F, etal., Laryngoscope. 2012 Aug;122(8):1724-33. doi: 10.1002/lary.23311. Epub 2012 May 1.
6.
Neuregulin signaling on glucose transport in muscle cells.
Canto C, etal., J Biol Chem. 2004 Mar 26;279(13):12260-8. Epub 2004 Jan 6.
7.
Expression of neuregulins and their putative receptors, ErbB2 and ErbB3, is induced during Wallerian degeneration.
Carroll SL, etal., J Neurosci 1997 Mar 1;17(5):1642-59.
8.
Hepatic expression of ErbB3 is repressed by insulin in a pathway sensitive to PI-3 kinase inhibitors.
Carver RS, etal., Endocrinology. 1997 Dec;138(12):5195-201.
9.
Diverse expression of ErbB receptor proteins during rat liver development and regeneration.
Carver RS, etal., Gastroenterology. 2002 Dec;123(6):2017-27.
10.
EGFR-activating mutations, DNA copy number abundance of ErbB family, and prognosis in lung adenocarcinoma.
Chen HY, etal., Oncotarget. 2016 Feb 23;7(8):9017-25. doi: 10.18632/oncotarget.7029.
11.
Bone microenvironment and androgen status modulate subcellular localization of ErbB3 in prostate cancer cells.
Cheng CJ, etal., Mol Cancer Res. 2007 Jul;5(7):675-84.
12.
EGF-ERBB signalling: towards the systems level.
Citri A and Yarden Y, Nat Rev Mol Cell Biol. 2006 Jul;7(7):505-16.
13.
Unique properties of lamp2a compared to other lamp2 isoforms.
Cuervo AM and Dice JF, J Cell Sci. 2000 Dec;113 Pt 24:4441-50.
14.
Protein levels and gene expressions of the epidermal growth factor receptors, HER1, HER2, HER3 and HER4 in benign and malignant ovarian tumors.
Dahl Steffensen K, etal., Int J Oncol. 2008 Jul;33(1):195-204.
15.
Changes in ErbB2 (her-2/neu), ErbB3, and ErbB4 during growth, differentiation, and apoptosis of normal rat mammary epithelial cells.
Darcy KM, etal., J Histochem Cytochem. 2000 Jan;48(1):63-80.
16.
HER family receptors expression in squamous cell carcinoma of the tongue: study of the possible prognostic and biological significance.
Del Sordo R, etal., J Oral Pathol Med. 2010 Jan;39(1):79-86. doi: 10.1111/j.1600-0714.2009.00815.x. Epub 2009 Aug 18.
17.
Neuregulin 1 growth factors regulate proliferation but not apoptosis of a CNS neuronal progenitor cell line.
Edwards JM and Bottenstein JE, Brain Res. 2006 Sep 7;1108(1):63-75. doi: 10.1016/j.brainres.2006.06.025. Epub 2006 Jul 21.
18.
Expression of the epidermal growth factor system in endometrioid endometrial cancer.
Ejskjaer K, etal., Gynecol Oncol. 2007 Jan;104(1):158-67. Epub 2006 Sep 7.
19.
Expression of ErbB3, ErbB4, and neuregulin-1 mRNA during tooth development.
Fried K, etal., Dev Dyn 2002 Jul;224(3):356-60.
20.
Constitutive activation of the neuregulin-1/ErbB receptor signaling pathway is essential for the proliferation of a neoplastic Schwann cell line.
Frohnert PW, etal., Glia. 2003 Aug;43(2):104-18.
21.
The prognostic significance of human epidermal growth factor receptor correlations in squamous cell cervical carcinoma.
Fuchs I, etal., Anticancer Res. 2007 Mar-Apr;27(2):959-63.
22.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
23.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
24.
Cloning of the rat ErbB3 cDNA and characterization of the recombinant protein.
Hellyer NJ, etal., Gene 1995 Nov 20;165(2):279-84.
25.
A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4.
Higashiyama S, etal., J Biochem (Tokyo) 1997 Sep;122(3):675-80.
26.
Expression and clinical significance of erb-B receptor family in hepatocellular carcinoma.
Ito Y, etal., Br J Cancer. 2001 May 18;84(10):1377-83. doi: 10.1054/bjoc.2000.1580.
27.
Expressions of tumor necrosis factor-converting enzyme and ErbB3 in rats with chronic obstructive pulmonary disease.
Ju CR, etal., Chin Med J (Engl). 2007 Sep 5;120(17):1505-10.
28.
Identification of patients with transitional cell carcinoma of the bladder overexpressing ErbB2, ErbB3, or specific ErbB4 isoforms: real-time reverse transcription-PCR analysis in estimation of ErbB receptor status from cancer patients.
Junttila TT, etal., Clin Cancer Res. 2003 Nov 1;9(14):5346-57.
29.
Expression of the HER family mRNA in breast cancer tissue and association with cell cycle inhibitors p21(waf1) and p27(kip1).
Kalemi TG, etal., Anticancer Res. 2007 Mar-Apr;27(2):913-20.
30.
Low nuclear ErbB3 predicts biochemical recurrence in patients with prostate cancer.
Koumakpayi IH, etal., BJU Int. 2007 Aug;100(2):303-9. Epub 2007 May 26.
31.
Prognostic significance of HER3 and HER4 protein expression in colorectal adenocarcinomas.
Kountourakis P, etal., BMC Cancer. 2006 Feb 28;6:46. doi: 10.1186/1471-2407-6-46.
32.
Immunohistochemical analysis of epidermal growth factor receptor family members in stage I non-small cell lung cancer.
Lai WW, etal., Ann Thorac Surg. 2001 Dec;72(6):1868-76. doi: 10.1016/s0003-4975(01)03207-6.
33.
Regulation of neuregulin/ErbB signaling by contractile activity in skeletal muscle.
Lebrasseur NK, etal., Am J Physiol Cell Physiol. 2003 May;284(5):C1149-55. Epub 2003 Jan 2.
34.
Whole-exome and targeted gene sequencing of gallbladder carcinoma identifies recurrent mutations in the ErbB pathway.
Li M, etal., Nat Genet. 2014 Aug;46(8):872-6. doi: 10.1038/ng.3030. Epub 2014 Jul 6.
35.
Soluble ErbB3 Levels in Bone Marrow and Plasma of Men with Prostate Cancer.
Lin SH, etal., Clin Cancer Res. 2008 Jun 15;14(12):3729-36.
36.
Expression of neuregulin and ErbB3 and ErbB4 after a traumatic lesion in the ventral funiculus of the spinal cord and in the intact primary olfactory system.
Lindholm T, etal., Exp Brain Res. 2002 Jan;142(1):81-90. Epub 2001 Nov 9.
37.
The ErbB4 receptor in fetal rat lung fibroblasts and epithelial type II cells.
Liu W, etal., Biochim Biophys Acta. 2007 Jul;1772(7):737-47. Epub 2007 May 5.
38.
Prognostic significance of serum ERBB3 and ERBB4 mRNA in lung adenocarcinoma patients.
Masroor M, etal., Tumour Biol. 2016 Jan;37(1):857-63. doi: 10.1007/s13277-015-3859-3. Epub 2015 Aug 9.
39.
Gene-specific inhibition of breast carcinoma in BALB-neuT mice by active immunization with rat Neu or human ErbB receptors.
Masuelli L, etal., Int J Oncol. 2007 Feb;30(2):381-92.
40.
Cross-talk between protein kinases Czeta and B in cyclic AMP-mediated sodium taurocholate co-transporting polypeptide translocation in hepatocytes.
McConkey M, etal., J Biol Chem. 2004 May 14;279(20):20882-8. Epub 2004 Mar 8.
41.
Erb and c-Kit receptors have distinctive patterns of expression in adult and developing taste papillae and taste buds.
McLaughlin SK J Neurosci. 2000 Aug 1;20(15):5679-88.
42.
The relation between survival and expression of HER1 and HER2 depends on the expression of HER3 and HER4: a study in bladder cancer patients.
Memon AA, etal., Br J Cancer. 2006 Jun 5;94(11):1703-9.
43.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
44.
Neuregulins and cancer.
Montero JC, etal., Clin Cancer Res. 2008 Jun 1;14(11):3237-41. doi: 10.1158/1078-0432.CCR-07-5133.
45.
Synapse-associated expression of an acetylcholine receptor-inducing protein, ARIA/heregulin, and its putative receptors, ErbB2 and ErbB3, in developing mammalian muscle.
Moscoso LM, etal., Dev Biol. 1995 Nov;172(1):158-69.
46.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
47.
Denervation and reinnervation of adult skeletal muscle modulate mRNA expression of neuregulin-1 and ErbB receptors.
Nicolino S, etal., Microsurgery. 2009;29(6):464-72. doi: 10.1002/micr.20636.
48.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
49.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
50.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
51.
GOA pipeline
RGD automated data pipeline
52.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
53.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
54.
An ATIPical family of angiotensin II AT2 receptor-interacting proteins.
Rodrigues-Ferreira S and Nahmias C, Trends Endocrinol Metab. 2010 Nov;21(11):684-90.
55.
Cytogenetic analysis of HER1/EGFR, HER2, HER3 and HER4 in 278 breast cancer patients.
Sassen A, etal., Breast Cancer Res. 2008 Jan 8;10(1):R2.
56.
ErbB receptors and fatty acid synthase expression in aggressive head and neck squamous cell carcinomas.
Silva SD, etal., Oral Dis. 2010 Nov;16(8):774-80. doi: 10.1111/j.1601-0825.2010.01687.x.
57.
Expression of the c-erbB-3/HER-3 and c-erbB-4/HER-4 growth factor receptors and their ligands, neuregulin-1 alpha, neuregulin-1 beta, and betacellulin, in normal endometrium and endometrial cancer.
Srinivasan R, etal., Clin Cancer Res. 1999 Oct;5(10):2877-83.
58.
Phyllodes tumor of the breast: EGFR family expression and relation to clinicopathological features.
Suo Z and Nesland JM, Ultrastruct Pathol. 2000 Nov-Dec;24(6):371-81.
59.
ErbB-3 predicts survival in ovarian cancer.
Tanner B, etal., J Clin Oncol. 2006 Sep 10;24(26):4317-23. Epub 2006 Aug 8.
60.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
61.
ERBB3 as an independent prognostic marker for nasopharyngeal carcinoma.
Tulalamba W, etal., J Clin Pathol. 2014 Aug;67(8):667-72. doi: 10.1136/jclinpath-2013-202154. Epub 2014 May 13.
62.
Enhancement of erbB2 and erbB3 expression during oral oncogenesis in diabetic rats.
Vairaktaris E, etal., J Cancer Res Clin Oncol. 2008 Mar;134(3):337-44. Epub 2007 Aug 18.
63.
Chronic antipsychotic drug administration alters the expression of neuregulin 1beta, ErbB2, ErbB3, and ErbB4 in the rat prefrontal cortex and hippocampus.
Wang XD, etal., Int J Neuropsychopharmacol. 2008 Jan 10;:1-9.
64.
Effect of regulation of the NRG1/ErbB4 signaling pathway on the visual cortex synaptic plasticity of amblyopic adult rats.
Xu L, etal., J Biochem Mol Toxicol. 2021 Sep;35(9):e22841. doi: 10.1002/jbt.22841. Epub 2021 Jul 17.
65.
A peptide antagonist of the ErbB1 receptor inhibits receptor activation, tumor cell growth and migration in vitro and xenograft tumor growth in vivo.
Xu R, etal., Cell Oncol. 2010 Jan 1;32(4):259-74. doi: 10.3233/CLO-2010-0515.
66.
HER2 Signaling Implicated in Regulating Alveolar Epithelial Permeability with Cyclic Stretch.
Yehya N, etal., Int J Mol Sci. 2019 Feb 22;20(4):948. doi: 10.3390/ijms20040948.
67.
Neuregulin receptors, erbB3 and erbB4, are localized at neuromuscular synapses.
Zhu X, etal., EMBO J. 1995 Dec 1;14(23):5842-8.
Erbb3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 1,579,079 - 1,600,379 (-) NCBI GRCr8 mRatBN7.2 7 994,549 - 1,015,876 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 996,225 - 1,015,525 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 3,758,331 - 3,777,703 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 5,634,321 - 5,653,694 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 5,932,064 - 5,951,447 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 2,989,202 - 3,010,610 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 2,989,340 - 3,010,350 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 2,962,964 - 2,984,938 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 1,858,057 - 1,877,353 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 1,858,056 - 1,877,353 (-) NCBI Celera 7 866,587 - 885,873 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
ERBB3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 56,080,108 - 56,103,505 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 56,076,799 - 56,103,505 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 56,473,892 - 56,497,289 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 54,760,159 - 54,783,395 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 54,760,158 - 54,783,395 NCBI Celera 12 56,125,560 - 56,149,315 (+) NCBI Celera Cytogenetic Map 12 q13.2 NCBI HuRef 12 53,512,788 - 53,536,430 (+) NCBI HuRef CHM1_1 12 56,441,254 - 56,464,656 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 56,047,558 - 56,071,109 (+) NCBI T2T-CHM13v2.0
Erbb3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 128,403,392 - 128,425,504 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 128,403,392 - 128,425,521 (-) Ensembl GRCm39 Ensembl GRCm38 10 128,567,523 - 128,589,635 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 128,567,523 - 128,589,652 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 128,006,424 - 128,026,557 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 127,972,317 - 127,992,450 (-) NCBI MGSCv36 mm8 Celera 10 130,961,356 - 130,981,519 (-) NCBI Celera Cytogenetic Map 10 D3 NCBI cM Map 10 77.1 NCBI
Erbb3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 3,683,126 - 3,702,978 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 3,683,126 - 3,701,752 (+) NCBI ChiLan1.0 ChiLan1.0
ERBB3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 38,228,227 - 38,251,623 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 38,224,995 - 38,248,393 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 32,811,533 - 32,834,958 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 33,062,681 - 33,085,426 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 33,063,434 - 33,084,994 (-) Ensembl panpan1.1 panPan2
ERBB3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 406,856 - 424,746 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 406,633 - 424,264 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 468,642 - 486,495 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 416,919 - 431,621 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 417,394 - 431,614 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 391,236 - 409,084 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 634,155 - 651,980 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 758,352 - 776,205 (+) NCBI UU_Cfam_GSD_1.0
Erbb3
ERBB3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 21,474,475 - 21,495,038 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 21,474,218 - 21,495,040 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 23,085,940 - 23,092,633 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ERBB3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 52,020,912 - 52,043,809 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 52,021,058 - 52,044,028 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 193,941,255 - 193,963,311 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Erbb3
.
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
7
2991317
2991318
T
G
snv
CDR View more Information
Predicted Target Of
Count of predictions: 80 Count of miRNA genes: 76 Interacting mature miRNAs: 80 Transcripts: ENSRNOT00000006796 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
Erbb3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 997,013 - 997,186 (+) MAPPER mRatBN7.2 Rnor_6.0 7 2,991,805 - 2,991,977 NCBI Rnor6.0 Rnor_5.0 7 2,965,429 - 2,965,601 UniSTS Rnor5.0 RGSC_v3.4 7 1,858,846 - 1,859,018 UniSTS RGSC3.4 Celera 7 867,376 - 867,548 UniSTS Cytogenetic Map 7 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006796 ⟹ ENSRNOP00000006796
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 996,225 - 1,015,525 (-) Ensembl Rnor_6.0 Ensembl 7 2,989,340 - 3,010,350 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097232 ⟹ ENSRNOP00000096071
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 996,225 - 1,015,525 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102209 ⟹ ENSRNOP00000084638
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 996,225 - 1,015,525 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115760 ⟹ ENSRNOP00000082134
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 996,225 - 1,015,525 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117138 ⟹ ENSRNOP00000088244
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 996,225 - 1,012,566 (-) Ensembl
RefSeq Acc Id:
NM_017218 ⟹ NP_058914
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,580,755 - 1,600,051 (-) NCBI mRatBN7.2 7 996,225 - 1,015,525 (-) NCBI Rnor_6.0 7 2,991,016 - 3,010,312 (-) NCBI Rnor_5.0 7 2,962,964 - 2,984,938 (-) NCBI RGSC_v3.4 7 1,858,057 - 1,877,353 (-) RGD Celera 7 866,587 - 885,873 (-) RGD
Sequence:
AGTTGCAGTTTGCAACCTCCGCTGCGGCCGCAGCTACCTATTCGCTGGCTGTTCAGGTGGCTTTCGCTTCGATGTCCTCCTAATCTTGGGGCCCCCGGGCCAGACTCGGGAGGGCTCCCTTCACCATC
hide sequence
RefSeq Acc Id:
XM_017594700 ⟹ XP_017450189
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,579,079 - 1,600,379 (-) NCBI mRatBN7.2 7 994,549 - 1,015,876 (-) NCBI Rnor_6.0 7 2,989,202 - 3,010,610 (-) NCBI
Sequence:
GCTCTCCTTACCCGCAGTCACTACCTTTCCCCGGCCTGGGGTCGTTTGGAATCTTGATCTCCTCTGAACCATCTCCGGAGGGAATTGCTGGAACAGACACCCTCCCCTGCCGCCCCGCTCCGGACTCT
hide sequence
RefSeq Acc Id:
XM_017594702 ⟹ XP_017450191
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,579,079 - 1,597,672 (-) NCBI mRatBN7.2 7 994,549 - 1,012,413 (-) NCBI Rnor_6.0 7 2,989,202 - 3,007,218 (-) NCBI
Sequence:
GCCTTAGTTGAGGAGAGGGTAAATGTTCCTGCCTAAAGTGTCCTTTCCAGGGAGAAGAAAAGCC
hide sequence
RefSeq Acc Id:
NP_058914 ⟸ NM_017218
- Peptide Label:
precursor
- UniProtKB:
Q62955 (UniProtKB/Swiss-Prot), Q62799 (UniProtKB/Swiss-Prot), A0A8I6A5T9 (UniProtKB/TrEMBL)
- Sequence:
MRATGTLQVLCFLLSLARGSEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSS
hide sequence
RefSeq Acc Id:
XP_017450189 ⟸ XM_017594700
- Peptide Label:
isoform X1
- UniProtKB:
G3V6N1 (UniProtKB/TrEMBL), A6KSF8 (UniProtKB/TrEMBL), A0A8I6A5T9 (UniProtKB/TrEMBL)
- Sequence:
MRATGTLQVLCFLLSLARGSEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVMGNLE
hide sequence
RefSeq Acc Id:
XP_017450191 ⟸ XM_017594702
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A5T9 (UniProtKB/TrEMBL)
- Sequence:
MGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLKFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRVRGAEIVVKNNGANCPPCH
hide sequence
Ensembl Acc Id:
ENSRNOP00000006796 ⟸ ENSRNOT00000006796
Ensembl Acc Id:
ENSRNOP00000096071 ⟸ ENSRNOT00000097232
Ensembl Acc Id:
ENSRNOP00000088244 ⟸ ENSRNOT00000117138
Ensembl Acc Id:
ENSRNOP00000082134 ⟸ ENSRNOT00000115760
Ensembl Acc Id:
ENSRNOP00000084638 ⟸ ENSRNOT00000102209
RGD ID: 13694945 Promoter ID: EPDNEW_R5470 Type: multiple initiation site Name: Erbb3_1 Description: erb-b2 receptor tyrosine kinase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 3,010,312 - 3,010,372 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-12-29
Erbb3
erb-b2 receptor tyrosine kinase 3
Erbb3
v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-08-01
Erbb3
v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
Erbb3
v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Erbb3
v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
avian erythroblastosis oncogene B 3
Name updated
1299863 APPROVED
2002-06-10
Erbb3
avian erythroblastosis oncogene B 3
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_product
member of the erB family of membrane tyrosine kinase receptors
68774
