Symbol:
Ifi27
Name:
interferon, alpha-inducible protein 27
RGD ID:
69404
Description:
Predicted to enable several functions, including RNA polymerase II-specific DNA-binding transcription factor binding activity; identical protein binding activity; and lamin binding activity. Involved in maternal process involved in female pregnancy; response to cytokine; and response to estradiol. Predicted to be located in nuclear inner membrane. Predicted to be active in mitochondrial membrane. Orthologous to human IFI27 (interferon alpha inducible protein 27); INTERACTS WITH (+)-schisandrin B; 1,2,4-trimethylbenzene; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Ifi27l; Ifi27l1; interferon alpha-inducible protein 27; interferon, alpha-inducible protein 27 like 1; interferon, alpha-inducible protein 27-like; IRG1; isg12(a); putative ISG12(a) protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 128,355,312 - 128,361,783 (+) NCBI GRCr8 mRatBN7.2 6 122,590,461 - 122,596,996 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 122,590,472 - 122,779,294 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 122,731,461 - 122,737,920 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 123,026,723 - 123,033,182 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 122,361,356 - 122,367,823 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 127,327,959 - 127,334,430 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 127,327,959 - 127,334,428 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 136,548,490 - 136,554,961 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 127,725,194 - 127,731,665 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 127,730,020 - 127,735,213 (+) NCBI Celera 6 120,071,215 - 120,077,686 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ifi27 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of IFI27 mRNA] CTD PMID:31150632 Ifi27 Rat (-)-demecolcine increases expression ISO RGD:1351661 6480464 Demecolcine results in increased expression of IFI27 mRNA CTD PMID:23649840 Ifi27 Rat (-)-epigallocatechin 3-gallate decreases expression ISO RGD:1351661 6480464 epigallocatechin gallate results in decreased expression of IFI27 mRNA CTD PMID:32512070 Ifi27 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:732169 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of IFI27 mRNA CTD PMID:36331819 Ifi27 Rat (S)-nicotine increases expression ISO RGD:1351661 6480464 Nicotine results in increased expression of IFI27 mRNA CTD PMID:23825647 Ifi27 Rat (S)-nicotine multiple interactions ISO RGD:1351661 6480464 Nicotine inhibits the reaction [nickel chloride results in increased expression of IFI27 mRNA] CTD PMID:37951547 Ifi27 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of IFI27 protein CTD PMID:17337753 Ifi27 Rat 1,2-dichloroethane decreases expression ISO RGD:732169 6480464 ethylene dichloride results in decreased expression of IFI27L1 mRNA CTD PMID:28960355 Ifi27 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:732169 6480464 1,2-Dimethylhydrazine results in decreased expression of IFI27L1 mRNA CTD PMID:22206623 Ifi27 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:732169 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of IFI27 mRNA CTD PMID:22206623 Ifi27 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO RGD:732169 6480464 Dinitrochlorobenzene results in increased expression of IFI27 mRNA CTD PMID:18242016 Ifi27 Rat 17beta-estradiol multiple interactions ISO RGD:1351661 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of IFI27 mRNA CTD PMID:19619570 Ifi27 Rat 17beta-estradiol decreases expression ISO RGD:732169 6480464 Estradiol results in decreased expression of IFI27 mRNA CTD PMID:39298647 Ifi27 Rat 17beta-estradiol increases expression ISO RGD:1351661 6480464 Estradiol results in increased expression of IFI27 mRNA CTD PMID:19619570|PMID:21185374 Ifi27 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:732169 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of IFI27 mRNA CTD PMID:30294300 Ifi27 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of IFI27L1 mRNA CTD PMID:20056577 Ifi27 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1351661 6480464 Tetrachlorodibenzodioxin results in decreased expression of IFI27 mRNA CTD PMID:19619570 Ifi27 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:732169 6480464 Tetrachlorodibenzodioxin results in decreased expression of IFI27 mRNA CTD PMID:33956508 Ifi27 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of IFI27 mRNA CTD PMID:32109520|PMID:34747641 Ifi27 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:732169 6480464 Tetrachlorodibenzodioxin affects the expression of IFI27 mRNA CTD PMID:21570461|PMID:26377647 Ifi27 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1351661 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of IFI27 mRNA CTD PMID:19619570 Ifi27 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1351661 6480464 Tetrachlorodibenzodioxin results in increased expression of IFI27 mRNA CTD PMID:16704738|PMID:20106945|PMID:21632981 Ifi27 Rat 2,4,6-trinitrobenzenesulfonic acid decreases expression ISO RGD:732169 6480464 Trinitrobenzenesulfonic Acid results in decreased expression of IFI27 mRNA CTD PMID:17982090 Ifi27 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:732169 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of IFI27 mRNA CTD PMID:38648751 Ifi27 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of IFI27 mRNA CTD PMID:21346803 Ifi27 Rat 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of IFI27 mRNA CTD PMID:27914987 Ifi27 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of IFI27 mRNA CTD PMID:28522335 Ifi27 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1351661 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression more ... CTD PMID:28628672 Ifi27 Rat 3-methylcholanthrene decreases expression ISO RGD:732169 6480464 Methylcholanthrene results in decreased expression of IFI27 mRNA CTD PMID:20713471 Ifi27 Rat 3-phenylprop-2-enal decreases expression ISO RGD:1351661 6480464 cinnamaldehyde results in decreased expression of IFI27 mRNA CTD PMID:19524605 Ifi27 Rat 4,4'-sulfonyldiphenol affects expression ISO RGD:732169 6480464 bisphenol S affects the expression of IFI27 mRNA CTD PMID:39298647 Ifi27 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO RGD:732169 6480464 Oxazolone results in increased expression of IFI27 mRNA CTD PMID:18242016 Ifi27 Rat 5-aza-2'-deoxycytidine increases expression ISO RGD:1351661 6480464 Decitabine results in increased expression of IFI27 mRNA CTD PMID:21856257 Ifi27 Rat 5-aza-2'-deoxycytidine multiple interactions ISO RGD:1351661 6480464 Decitabine inhibits the reaction [Smoke results in decreased expression of IFI27 mRNA] CTD PMID:21095227 Ifi27 Rat 6alpha-methylprednisolone decreases expression ISO RGD:1351661 6480464 Methylprednisolone results in decreased expression of IFI27 mRNA CTD PMID:19192274 Ifi27 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of IFI27 mRNA CTD PMID:28959563 Ifi27 Rat acrylamide increases expression ISO RGD:1351661 6480464 Acrylamide results in increased expression of IFI27 mRNA CTD PMID:32763439 Ifi27 Rat aflatoxin B1 affects expression ISO RGD:1351661 6480464 Aflatoxin B1 affects the expression of IFI27 protein CTD PMID:20106945 Ifi27 Rat all-trans-retinoic acid increases expression ISO RGD:1351661 6480464 Tretinoin results in increased expression of IFI27 mRNA CTD PMID:33167477 Ifi27 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of IFI27 mRNA CTD PMID:35163327 Ifi27 Rat amantadine increases expression ISO RGD:1351661 6480464 Amantadine results in increased expression of IFI27 mRNA CTD PMID:16756086 Ifi27 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of IFI27L1 mRNA CTD PMID:16483693 Ifi27 Rat aristolochic acid A increases expression ISO RGD:1351661 6480464 aristolochic acid I results in increased expression of IFI27 mRNA CTD PMID:33212167 Ifi27 Rat asperentin decreases expression ISO RGD:732169 6480464 cladosporin results in decreased expression of IFI27L1 mRNA CTD PMID:21356202 Ifi27 Rat atazanavir sulfate multiple interactions ISO RGD:1351661 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Ifi27 Rat atrazine decreases expression ISO RGD:732169 6480464 Atrazine results in decreased expression of IFI27 mRNA CTD PMID:27655631 Ifi27 Rat avobenzone multiple interactions ISO RGD:1351661 6480464 avobenzone inhibits the reaction [IFI27 mRNA results in increased expression of BTBD7 mRNA]; IFI27 mRNA more ... CTD PMID:29981360 Ifi27 Rat avobenzone increases expression ISO RGD:1351661 6480464 avobenzone results in increased expression of IFI27 mRNA CTD PMID:29981360 Ifi27 Rat azathioprine decreases expression ISO RGD:1351661 6480464 Azathioprine results in decreased expression of IFI27 mRNA CTD PMID:19192274 Ifi27 Rat benzo[a]pyrene multiple interactions ISO RGD:1351661 6480464 chlorophyllin inhibits the reaction [Benzo(a)pyrene results in increased expression of IFI27 mRNA] CTD PMID:19152381 Ifi27 Rat benzo[a]pyrene multiple interactions ISO RGD:732169 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of IFI27L1 mRNA] CTD PMID:22228805 Ifi27 Rat benzo[a]pyrene increases methylation ISO RGD:1351661 6480464 Benzo(a)pyrene results in increased methylation of IFI27 3' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Ifi27 Rat benzo[a]pyrene increases expression ISO RGD:732169 6480464 Benzo(a)pyrene results in increased expression of IFI27 mRNA; Benzo(a)pyrene results in increased expression of IFI27L1 more ... CTD PMID:22228805 Ifi27 Rat benzo[a]pyrene increases expression ISO RGD:1351661 6480464 Benzo(a)pyrene results in increased expression of IFI27 mRNA CTD PMID:19152381|PMID:20106945|PMID:22316170 Ifi27 Rat Benzo[ghi]perylene decreases expression ISO RGD:732169 6480464 1,12-benzoperylene results in decreased expression of IFI27L1 mRNA CTD PMID:26377693 Ifi27 Rat bis(2-chloroethyl) sulfide increases expression ISO RGD:1351661 6480464 Mustard Gas results in increased expression of IFI27 mRNA CTD PMID:25102026 Ifi27 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:732169 6480464 Diethylhexyl Phthalate results in increased expression of IFI27 mRNA CTD PMID:33754040 Ifi27 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of IFI27 mRNA CTD PMID:25181051 Ifi27 Rat bisphenol A increases expression ISO RGD:732169 6480464 bisphenol A results in increased expression of IFI27 mRNA CTD PMID:33221593 Ifi27 Rat bisphenol A decreases expression ISO RGD:732169 6480464 bisphenol A results in decreased expression of IFI27 mRNA CTD PMID:30245210|PMID:35598803 Ifi27 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of IFI27 mRNA CTD PMID:30903817 Ifi27 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of IFI27 gene CTD PMID:28505145 Ifi27 Rat bisphenol F increases expression ISO RGD:732169 6480464 bisphenol F results in increased expression of IFI27 mRNA CTD PMID:30951980 Ifi27 Rat butanal increases expression ISO RGD:1351661 6480464 butyraldehyde results in increased expression of IFI27 mRNA CTD PMID:26079696 Ifi27 Rat cadmium atom multiple interactions ISO RGD:1351661 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of IFI27 more ... CTD PMID:35301059 Ifi27 Rat cadmium dichloride decreases expression ISO RGD:1351661 6480464 Cadmium Chloride results in decreased expression of IFI27 mRNA CTD PMID:38382870 Ifi27 Rat cadmium dichloride multiple interactions ISO RGD:1351661 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of IFI27 more ... CTD PMID:35301059 Ifi27 Rat calcitriol decreases expression ISO RGD:1351661 6480464 Calcitriol results in decreased expression of IFI27 mRNA CTD PMID:26485663 Ifi27 Rat carbon nanotube decreases expression ISO RGD:732169 6480464 Nanotubes, Carbon analog results in decreased expression of IFI27L1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25620056 Ifi27 Rat chenodeoxycholic acid multiple interactions ISO RGD:1351661 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Ifi27 Rat chlordecone increases expression ISO RGD:732169 6480464 Chlordecone results in increased expression of IFI27 mRNA CTD PMID:33711761 Ifi27 Rat chlordecone decreases expression ISO RGD:732169 6480464 Chlordecone results in decreased expression of IFI27 mRNA CTD PMID:33711761 Ifi27 Rat chlorophyllin multiple interactions ISO RGD:1351661 6480464 chlorophyllin inhibits the reaction [Benzo(a)pyrene results in increased expression of IFI27 mRNA] CTD PMID:19152381 Ifi27 Rat choline multiple interactions ISO RGD:732169 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Ifi27 Rat ciguatoxin CTX1B affects expression ISO RGD:732169 6480464 Ciguatoxins affects the expression of IFI27 mRNA CTD PMID:18353800 Ifi27 Rat cisplatin decreases expression ISO RGD:1351661 6480464 Cisplatin results in decreased expression of IFI27 mRNA CTD PMID:27392435 Ifi27 Rat cisplatin multiple interactions ISO RGD:1351661 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of IFI27 mRNA CTD PMID:27392435 Ifi27 Rat clofibrate multiple interactions ISO RGD:732169 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of IFI27L1 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Ifi27 Rat clofibrate decreases expression ISO RGD:732169 6480464 Clofibrate results in decreased expression of IFI27L1 mRNA CTD PMID:17585979 Ifi27 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of IFI27 mRNA CTD PMID:17602206 Ifi27 Rat cobalt dichloride increases expression ISO RGD:732169 6480464 cobaltous chloride results in increased expression of IFI27 mRNA; cobaltous chloride results in increased expression more ... CTD PMID:21139344 Ifi27 Rat copper atom multiple interactions ISO RGD:732169 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ... CTD PMID:15467011 Ifi27 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of IFI27 mRNA CTD PMID:30556269 Ifi27 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of IFI27 mRNA CTD PMID:30556269 Ifi27 Rat copper(0) multiple interactions ISO RGD:732169 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ... CTD PMID:15467011 Ifi27 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of IFI27 mRNA CTD PMID:26577399 Ifi27 Rat cyclosporin A multiple interactions ISO RGD:1351661 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Ifi27 Rat DDE decreases expression ISO RGD:1351661 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of IFI27 mRNA CTD PMID:38568856 Ifi27 Rat deoxycholic acid multiple interactions ISO RGD:1351661 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Ifi27 Rat dexamethasone multiple interactions ISO RGD:1351661 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression more ... CTD PMID:28628672 Ifi27 Rat diclofenac decreases expression ISO RGD:1351661 6480464 Diclofenac results in decreased expression of IFI27 mRNA CTD PMID:19192274 Ifi27 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of IFI27 mRNA CTD PMID:25152437 Ifi27 Rat diuron decreases expression ISO RGD:1351661 6480464 Diuron results in decreased expression of IFI27 mRNA CTD PMID:35967413 Ifi27 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of IFI27 mRNA CTD PMID:21551480 Ifi27 Rat doxorubicin decreases expression ISO RGD:1351661 6480464 Doxorubicin results in decreased expression of IFI27 mRNA CTD PMID:29803840 Ifi27 Rat finasteride decreases expression EXP 6480464 Finasteride results in decreased expression of IFI27 mRNA CTD PMID:24136188 Ifi27 Rat folic acid multiple interactions ISO RGD:732169 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of IFI27 mRNA; [Methionine deficiency co-treated more ... CTD PMID:20938992|PMID:22206623 Ifi27 Rat formaldehyde decreases expression ISO RGD:1351661 6480464 Formaldehyde results in decreased expression of IFI27 mRNA CTD PMID:28937961 Ifi27 Rat furan decreases expression EXP 6480464 furan results in decreased expression of IFI27 mRNA CTD PMID:26194646 Ifi27 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of IFI27 mRNA CTD PMID:22061828 Ifi27 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of IFI27 mRNA CTD PMID:24395379 Ifi27 Rat glycochenodeoxycholic acid multiple interactions ISO RGD:1351661 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Ifi27 Rat glycocholic acid multiple interactions ISO RGD:1351661 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Ifi27 Rat glycodeoxycholic acid multiple interactions ISO RGD:1351661 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Ifi27 Rat hydrogen peroxide affects expression ISO RGD:1351661 6480464 Hydrogen Peroxide affects the expression of IFI27 mRNA CTD PMID:20044591 Ifi27 Rat indometacin multiple interactions ISO RGD:1351661 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression more ... CTD PMID:28628672 Ifi27 Rat inulin multiple interactions ISO RGD:732169 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of IFI27 mRNA CTD PMID:36331819 Ifi27 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of IFI27 mRNA; Ketamine results in increased expression of IFI27L1 more ... CTD PMID:20080153 Ifi27 Rat L-ascorbic acid increases expression EXP 6480464 Ascorbic Acid results in increased expression of IFI27 mRNA CTD PMID:15372504 Ifi27 Rat L-methionine multiple interactions ISO RGD:732169 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Ifi27 Rat lipopolysaccharide increases expression ISO RGD:732169 6480464 Lipopolysaccharides results in increased expression of IFI27L1 mRNA CTD PMID:21356202 Ifi27 Rat lipopolysaccharide increases expression ISO RGD:1351661 6480464 Lipopolysaccharides results in increased expression of IFI27 mRNA CTD PMID:35811015 Ifi27 Rat lipopolysaccharide multiple interactions ISO RGD:1351661 6480464 S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of IFI27 mRNA] CTD PMID:35811015 Ifi27 Rat methcathinone affects expression ISO RGD:1351661 6480464 monomethylpropion affects the expression of IFI27 mRNA CTD PMID:22303338 Ifi27 Rat methotrexate decreases expression ISO RGD:1351661 6480464 Methotrexate results in decreased expression of IFI27 mRNA CTD PMID:19192274 Ifi27 Rat mycotoxin affects expression ISO RGD:732169 6480464 Mycotoxins affects the expression of IFI27L1 mRNA CTD PMID:21356202 Ifi27 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO RGD:1351661 6480464 N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine results in increased expression of IFI27 mRNA CTD PMID:12756304 Ifi27 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of IFI27 mRNA CTD PMID:17602206 Ifi27 Rat nefazodone multiple interactions ISO RGD:1351661 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Ifi27 Rat neoechinulin A increases expression ISO RGD:732169 6480464 neoechinulin A results in increased expression of IFI27L1 mRNA CTD PMID:21356202 Ifi27 Rat nickel atom increases expression ISO RGD:1351661 6480464 Nickel results in increased expression of IFI27 mRNA CTD PMID:24768652 Ifi27 Rat nickel dichloride multiple interactions ISO RGD:1351661 6480464 Nicotine inhibits the reaction [nickel chloride results in increased expression of IFI27 mRNA] CTD PMID:37951547 Ifi27 Rat nickel dichloride increases expression ISO RGD:1351661 6480464 nickel chloride results in increased expression of IFI27 mRNA CTD PMID:37951547 Ifi27 Rat nicotine increases expression ISO RGD:1351661 6480464 Nicotine results in increased expression of IFI27 mRNA CTD PMID:23825647 Ifi27 Rat nicotine multiple interactions ISO RGD:1351661 6480464 Nicotine inhibits the reaction [nickel chloride results in increased expression of IFI27 mRNA] CTD PMID:37951547 Ifi27 Rat okadaic acid increases expression ISO RGD:1351661 6480464 Okadaic Acid results in increased expression of IFI27 mRNA CTD PMID:38832940 Ifi27 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of IFI27 mRNA CTD PMID:25729387 Ifi27 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of IFI27 mRNA CTD PMID:25729387 Ifi27 Rat ozone decreases expression ISO RGD:732169 6480464 Ozone results in decreased expression of IFI27 mRNA CTD PMID:12763052 Ifi27 Rat ozone multiple interactions ISO RGD:732169 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of IFI27 more ... CTD PMID:34911549 Ifi27 Rat paracetamol decreases expression ISO RGD:1351661 6480464 Acetaminophen results in decreased expression of IFI27 mRNA CTD PMID:26690555|PMID:29067470 Ifi27 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of IFI27 mRNA CTD PMID:33387578 Ifi27 Rat paracetamol multiple interactions ISO RGD:1351661 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Ifi27 Rat paracetamol increases expression ISO RGD:732169 6480464 Acetaminophen results in increased expression of IFI27L1 mRNA CTD PMID:17585979 Ifi27 Rat paracetamol multiple interactions ISO RGD:732169 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of IFI27L1 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Ifi27 Rat pentachlorophenol increases expression ISO RGD:732169 6480464 Pentachlorophenol results in increased expression of IFI27L1 mRNA CTD PMID:23892564 Ifi27 Rat pentanal increases expression ISO RGD:1351661 6480464 pentanal results in increased expression of IFI27 mRNA CTD PMID:26079696 Ifi27 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:732169 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of IFI27 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Ifi27 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of IFI27 mRNA CTD PMID:35163327 Ifi27 Rat phenobarbital decreases expression ISO RGD:732169 6480464 Phenobarbital results in decreased expression of IFI27 mRNA CTD PMID:19270015|PMID:31836555 Ifi27 Rat phenobarbital affects expression ISO RGD:732169 6480464 Phenobarbital affects the expression of IFI27L1 mRNA CTD PMID:23091169 Ifi27 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of IFI27 mRNA CTD PMID:16940010 Ifi27 Rat pirinixic acid decreases expression ISO RGD:732169 6480464 pirinixic acid results in decreased expression of IFI27L1 mRNA CTD PMID:23811191 Ifi27 Rat pirinixic acid multiple interactions ISO RGD:732169 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Ifi27 Rat piroxicam decreases expression ISO RGD:1351661 6480464 Piroxicam results in decreased expression of IFI27 mRNA CTD PMID:19192274 Ifi27 Rat prednisolone decreases expression ISO RGD:1351661 6480464 Prednisolone results in decreased expression of IFI27 mRNA CTD PMID:19192274 Ifi27 Rat protein kinase inhibitor multiple interactions ISO RGD:1351661 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of IFI27 mRNA] CTD PMID:28003376 Ifi27 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1351661 6480464 S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of IFI27 mRNA] CTD PMID:35811015 Ifi27 Rat silicon dioxide increases expression ISO RGD:1351661 6480464 Silicon Dioxide results in increased expression of IFI27 mRNA CTD PMID:22300531 Ifi27 Rat silicon dioxide decreases expression ISO RGD:1351661 6480464 Silicon Dioxide analog results in decreased expression of IFI27 mRNA CTD PMID:25895662 Ifi27 Rat silver atom increases expression ISO RGD:732169 6480464 Silver results in increased expression of IFI27L1 mRNA CTD PMID:27131904 Ifi27 Rat silver(0) increases expression ISO RGD:732169 6480464 Silver results in increased expression of IFI27L1 mRNA CTD PMID:27131904 Ifi27 Rat sodium arsenite increases expression ISO RGD:1351661 6480464 sodium arsenite results in increased expression of IFI27 mRNA CTD PMID:22714537|PMID:38568856 Ifi27 Rat sodium arsenite decreases expression ISO RGD:1351661 6480464 sodium arsenite results in decreased expression of IFI27 mRNA CTD PMID:35954277 Ifi27 Rat sodium aurothiomalate decreases expression ISO RGD:1351661 6480464 Gold Sodium Thiomalate results in decreased expression of IFI27 mRNA CTD PMID:19192274 Ifi27 Rat succimer multiple interactions ISO RGD:1351661 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of IFI27 mRNA CTD PMID:26378955 Ifi27 Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of IFI27 mRNA CTD PMID:24136188 Ifi27 Rat tamoxifen increases expression ISO RGD:1351661 6480464 Tamoxifen results in increased expression of IFI27 mRNA CTD PMID:19155303 Ifi27 Rat tamoxifen affects expression ISO RGD:732169 6480464 Tamoxifen affects the expression of IFI27 mRNA CTD PMID:20937368 Ifi27 Rat tartrazine multiple interactions ISO RGD:1351661 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Ifi27 Rat temozolomide increases expression ISO RGD:1351661 6480464 Temozolomide results in increased expression of IFI27 mRNA CTD PMID:31758290 Ifi27 Rat tert-butyl hydroperoxide decreases expression ISO RGD:1351661 6480464 tert-Butylhydroperoxide results in decreased expression of IFI27 mRNA CTD PMID:15336504 Ifi27 Rat tert-butyl hydroperoxide increases expression ISO RGD:732169 6480464 tert-Butylhydroperoxide results in increased expression of IFI27 mRNA CTD PMID:15003993 Ifi27 Rat testosterone decreases expression ISO RGD:1351661 6480464 Testosterone results in decreased expression of IFI27 mRNA CTD PMID:33359661 Ifi27 Rat testosterone enanthate affects expression ISO RGD:1351661 6480464 testosterone enanthate affects the expression of IFI27 mRNA CTD PMID:17440010 Ifi27 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of IFI27 mRNA] CTD PMID:31150632 Ifi27 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of IFI27 mRNA CTD PMID:31150632 Ifi27 Rat tetraphene decreases expression ISO RGD:732169 6480464 benz(a)anthracene results in decreased expression of IFI27L1 mRNA CTD PMID:26377693 Ifi27 Rat titanium dioxide increases expression ISO RGD:732169 6480464 titanium dioxide results in increased expression of IFI27 mRNA CTD PMID:23557971 Ifi27 Rat titanium dioxide affects expression ISO RGD:732169 6480464 titanium dioxide affects the expression of IFI27 mRNA CTD PMID:27760801 Ifi27 Rat tofacitinib decreases expression ISO RGD:1351661 6480464 tofacitinib results in decreased expression of IFI27 mRNA CTD PMID:25487280 Ifi27 Rat toluene 2,4-diisocyanate increases expression ISO RGD:732169 6480464 Toluene 2,4-Diisocyanate results in increased expression of IFI27 mRNA CTD PMID:18242016 Ifi27 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of IFI27 mRNA CTD PMID:25729387 Ifi27 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of IFI27 mRNA CTD PMID:25729387 Ifi27 Rat valproic acid increases methylation ISO RGD:1351661 6480464 Valproic Acid results in increased methylation of IFI27 gene CTD PMID:29154799 Ifi27 Rat valproic acid affects expression ISO RGD:732169 6480464 Valproic Acid affects the expression of IFI27L1 mRNA CTD PMID:17292431 Ifi27 Rat valproic acid decreases expression ISO RGD:1351661 6480464 Valproic Acid results in decreased expression of IFI27 mRNA CTD PMID:29154799 Ifi27 Rat vancomycin decreases expression ISO RGD:732169 6480464 Vancomycin results in decreased expression of IFI27 mRNA CTD PMID:18930951 Ifi27 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of IFI27 mRNA CTD PMID:19015723 Ifi27 Rat zidovudine multiple interactions ISO RGD:1351661 6480464 [Zidovudine co-treated with IFNA1 protein] results in increased expression of IFI27 mRNA CTD PMID:20370541 Ifi27 Rat zinc sulfate decreases expression ISO RGD:1351661 6480464 Zinc Sulfate results in decreased expression of IFI27 mRNA CTD PMID:12756304 Ifi27 Rat zoledronic acid increases expression ISO RGD:1351661 6480464 zoledronic acid results in increased expression of IFI27 mRNA CTD PMID:24714768
(+)-schisandrin B (EXP) (-)-demecolcine (ISO) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 3-phenylprop-2-enal (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 5-aza-2'-deoxycytidine (ISO) 6alpha-methylprednisolone (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amantadine (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) asperentin (ISO) atazanavir sulfate (ISO) atrazine (ISO) avobenzone (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) Benzo[ghi]perylene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) chenodeoxycholic acid (ISO) chlordecone (ISO) chlorophyllin (ISO) choline (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clofibrate (ISO) clofibric acid (EXP) cobalt dichloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) Cuprizon (EXP) cyclosporin A (ISO) DDE (ISO) deoxycholic acid (ISO) dexamethasone (ISO) diclofenac (ISO) diuron (EXP,ISO) doxorubicin (ISO) finasteride (EXP) folic acid (ISO) formaldehyde (ISO) furan (EXP) gentamycin (EXP) glycidol (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) hydrogen peroxide (ISO) indometacin (ISO) inulin (ISO) ketamine (EXP) L-ascorbic acid (EXP) L-methionine (ISO) lipopolysaccharide (ISO) methcathinone (ISO) methotrexate (ISO) mycotoxin (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-nitrosodiethylamine (EXP) nefazodone (ISO) neoechinulin A (ISO) nickel atom (ISO) nickel dichloride (ISO) nicotine (ISO) okadaic acid (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) pentachlorophenol (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) pirinixic acid (EXP,ISO) piroxicam (ISO) prednisolone (ISO) protein kinase inhibitor (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium aurothiomalate (ISO) succimer (ISO) sulindac (EXP) tamoxifen (ISO) tartrazine (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) testosterone enanthate (ISO) tetrachloromethane (EXP) tetraphene (ISO) titanium dioxide (ISO) tofacitinib (ISO) toluene 2,4-diisocyanate (ISO) topotecan (EXP) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) zidovudine (ISO) zinc sulfate (ISO) zoledronic acid (ISO)
Ifi27 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 128,355,312 - 128,361,783 (+) NCBI GRCr8 mRatBN7.2 6 122,590,461 - 122,596,996 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 122,590,472 - 122,779,294 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 122,731,461 - 122,737,920 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 123,026,723 - 123,033,182 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 122,361,356 - 122,367,823 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 127,327,959 - 127,334,430 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 127,327,959 - 127,334,428 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 136,548,490 - 136,554,961 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 127,725,194 - 127,731,665 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 127,730,020 - 127,735,213 (+) NCBI Celera 6 120,071,215 - 120,077,686 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
IFI27 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 94,105,894 - 94,116,690 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 94,104,836 - 94,116,695 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 94,577,082 - 94,583,027 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 93,646,832 - 93,652,786 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 93,646,831 - 93,652,786 NCBI Celera 14 74,630,847 - 74,636,810 (+) NCBI Celera Cytogenetic Map 14 q32.12 NCBI HuRef 14 74,756,896 - 74,762,859 (+) NCBI HuRef CHM1_1 14 94,515,076 - 94,521,039 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 88,338,053 - 88,343,998 (+) NCBI T2T-CHM13v2.0
Ifi27 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 103,400,448 - 103,406,504 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 103,400,470 - 103,406,498 (+) Ensembl GRCm39 Ensembl GRCm38 12 103,434,189 - 103,440,245 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 103,434,211 - 103,440,239 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 104,672,399 - 104,678,455 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 103,835,261 - 103,841,257 (+) NCBI MGSCv36 mm8 Celera 12 104,650,946 - 104,657,006 (+) NCBI Celera Cytogenetic Map 12 E NCBI cM Map 12 52.93 NCBI
IFI27 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 95,267,999 - 95,274,043 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 94,484,504 - 94,490,548 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 74,742,775 - 74,748,820 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 94,046,696 - 94,082,022 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 94,046,694 - 94,082,022 (+) Ensembl panpan1.1 panPan2
IFI27 (Chlorocebus sabaeus - green monkey)
.
Predicted Target Of
Count of predictions: 128 Count of miRNA genes: 93 Interacting mature miRNAs: 99 Transcripts: ENSRNOT00000012296, ENSRNOT00000063970 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 61329 Eae9 Experimental allergic encephalomyelitis QTL 9 3.7 body mass (VT:0001259) change in body weight (CMO:0002045) 6 122549046 140994061 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1641917 Colcr5 Colorectal carcinoma resistance QTL 5 3.18 0.0009 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 6 122549046 137801795 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 1298087 Iddm18 Insulin dependent diabetes mellitus QTL 18 0.0001 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 6 116506292 130245370 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat 2293085 Iddm29 Insulin dependent diabetes mellitus QTL 29 7.66 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 122549046 140286318 Rat
RH136878
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 122,596,814 - 122,596,968 (+) MAPPER mRatBN7.2 Rnor_6.0 6 127,334,249 - 127,334,402 NCBI Rnor6.0 Rnor_5.0 6 136,554,780 - 136,554,933 UniSTS Rnor5.0 RGSC_v3.4 6 127,731,484 - 127,731,637 UniSTS RGSC3.4 Celera 6 120,077,505 - 120,077,658 UniSTS RH 3.4 Map 6 835.8 UniSTS Cytogenetic Map 6 q32 UniSTS
RH138407
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 122,594,413 - 122,594,649 (+) MAPPER mRatBN7.2 Rnor_6.0 6 127,331,848 - 127,332,083 NCBI Rnor6.0 Rnor_5.0 6 136,552,379 - 136,552,614 UniSTS Rnor5.0 RGSC_v3.4 6 127,729,083 - 127,729,318 UniSTS RGSC3.4 Celera 6 120,075,104 - 120,075,339 UniSTS RH 3.4 Map 6 835.5 UniSTS Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012296 ⟹ ENSRNOP00000012296
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 122,590,504 - 122,779,294 (+) Ensembl Rnor_6.0 Ensembl 6 127,327,959 - 127,334,428 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000063970 ⟹ ENSRNOP00000060106
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 122,590,500 - 122,596,992 (+) Ensembl Rnor_6.0 Ensembl 6 127,333,590 - 127,334,324 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095734 ⟹ ENSRNOP00000081720
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 122,590,472 - 122,596,989 (+) Ensembl
RefSeq Acc Id:
NM_203410 ⟹ NP_981955
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 128,355,312 - 128,361,783 (+) NCBI mRatBN7.2 6 122,590,525 - 122,596,996 (+) NCBI Rnor_6.0 6 127,327,959 - 127,334,430 (+) NCBI Rnor_5.0 6 136,548,490 - 136,554,961 (+) NCBI RGSC_v3.4 6 127,725,194 - 127,731,665 (+) RGD Celera 6 120,071,215 - 120,077,686 (+) RGD
Sequence:
GGGACACCAAAACCTATCTCATCCTCTCACTTACATCACTGGGTTTGGCTCCTATCTGGAACGCACACCGGTCCCCATGGCATTGTCTGGCACAGGTACGCTGGTGGCTTCTATTGCCTCCAAGGTGG CATCTTCAGTGGCCGTGGTCAAAGCCGGAGGGGCGGTATCCAGCACCATCCTAGCTAGCTCACAGGGGCTCAACTTGTTAGCCCAGACTGCACTGGGCTCTGGAGCTTCTGCACTTGGATCTGCATTG GGAGCACTGAAGGCTGGCACCGTTTTATCCAGCCTCCCTGCCTCCGCCTTGGCTGTTTGCCCCATTGGAGTCAAGACTGCTGTCGCCATGCTTGGGGGAGCCGTGACAGTAGCTGCGGTTCCACCTGT GCTGAGTGCCGTGGGCTTCACTGGGTCAGGCATTGCAGCCTCCTCTCTAGCAGCCAAGCTGATGTCTGTGTCAGCCATTGCTAATGGGGGCGGAGTCCCAGCTGGTGGCCTGGTGGCCACTCTGCAGT CTGCTGGAGCTGCTGGACTCTCCATGACATCTAAGGTCCTCGTGGGCTCTACAGGGTCTGCCGTTGTGGCCAGTGTGATGGGTGTCTGTAAGCATTTGTACTCCTTCCTCTGATAATTGTACTTGGAA ACCAAGGTGGCTGACATGGCAAGAGAGGAGGCAGACATGGGAACAGAGGTGTCGCCACTCAGCTTGTCTAATCCGGAGAGGGATTAATTAGCCCCAGGGGACAATTTACTATCACAGATTGCCTACGT GGAAATAAGAAATAAAACCAAGTGCTTGCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_063261494 ⟹ XP_063117564
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 128,355,343 - 128,361,783 (+) NCBI
RefSeq Acc Id:
NP_981955 ⟸ NM_203410
- UniProtKB:
A6JEN2 (UniProtKB/TrEMBL), G3V761 (UniProtKB/TrEMBL), Q6P9X5 (UniProtKB/TrEMBL)
- Sequence:
MALSGTGTLVASIASKVASSVAVVKAGGAVSSTILASSQGLNLLAQTALGSGASALGSALGALKAGTVLSSLPASALAVCPIGVKTAVAMLGGAVTVAAVPPVLSAVGFTGSGIAASSLAAKLMSVSA IANGGGVPAGGLVATLQSAGAAGLSMTSKVLVGSTGSAVVASVMGVCKHLYSFL
hide sequence
Ensembl Acc Id:
ENSRNOP00000012296 ⟸ ENSRNOT00000012296
Ensembl Acc Id:
ENSRNOP00000060106 ⟸ ENSRNOT00000063970
Ensembl Acc Id:
ENSRNOP00000081720 ⟸ ENSRNOT00000095734
RefSeq Acc Id:
XP_063117564 ⟸ XM_063261494
- Peptide Label:
isoform X1
RGD ID: 13694794
Promoter ID: EPDNEW_R5318
Type: initiation region
Name: Ifi27_1
Description: interferon, alpha-inducible protein 27
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 127,327,929 - 127,327,989 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-04-13
Ifi27
interferon, alpha-inducible protein 27
Ifi27l1
interferon, alpha-inducible protein 27 like 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2009-05-18
Ifi27l1
interferon, alpha-inducible protein 27 like 1
Ifi27l
interferon, alpha-inducible protein 27-like
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-10-16
Ifi27l
interferon, alpha-inducible protein 27-like
isg12(a)
putative ISG12(a) protein
Data merged from RGD:1303168
737654
APPROVED
2005-09-30
isg12(a)
Symbol and Name status set to provisional
70820
PROVISIONAL
2002-06-10
Ifi27l
interferon, alpha-inducible protein 27-like
Symbol and Name status set to approved
70586
APPROVED
Note Type
Note
Reference
gene_expression
expressed in endometrial epithelium and surrounding stroma during preimplantation
68731
gene_expression
maximal expression requires estrogen and IFN-alpha
68731
gene_regulation
induced by interfern-alpha
68731