Advanced Search (OLGA)

Gene: Kcnk12 (potassium two pore domain channel subfamily K member 12) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Kcnk12

Name:

potassium two pore domain channel subfamily K member 12

RGD ID:

68940

Description:

Predicted to enable identical protein binding activity; potassium channel activity; and protein heterodimerization activity. Predicted to be involved in potassium ion transmembrane transport. Predicted to be located in endoplasmic reticulum membrane. Predicted to be part of monoatomic ion channel complex. Predicted to be active in plasma membrane. Orthologous to human KCNK12 (potassium two pore domain channel subfamily K member 12); INTERACTS WITH 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

potassium channel subfamily K member 12; potassium channel, subfamily K, member 12; potassium channel, two pore domain subfamily K, member 12; tandem pore domain halothane-inhibited potassium channel 2; tandem pore domain potassium channel THIK-2; THIK-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

NCBI Annotation Information:

Note: There is an assembly problem in the Rnor_6.0 reference genome assembly, and therefore, annotation of this gene is split across NW_007905828.1 and NW_007905829.1 in NCBI's Rattus norvegicus Annotation Release 105. [17 Jun 2015]

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	12,492,609 - 12,544,250 (+)	NCBI		GRCr8
mRatBN7.2	6	6,740,147 - 6,790,664 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	6,739,991 - 6,790,661 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	7,023,487 - 7,072,825 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	7,332,899 - 7,382,229 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	6,860,027 - 6,909,361 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	11,373,917 - 11,494,459 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	11,373,917 - 11,494,459 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	21,346,993 - 21,464,940 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	11,281,814 - 11,353,795 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	11,281,813 - 11,353,795 (-)	NCBI
Celera	6	6,499,476 - 6,548,106 (+)	NCBI		Celera
Cytogenetic Map	6	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnk12	Rat	Hereditary Neoplastic Syndromes		ISO	KCNK12 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:24728327 and PMID:25741868
Kcnk12	Rat	Lynch syndrome		ISO	KCNK12 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary nonpolyposis colorectal neoplasms	ClinVar	PMID:18269114 more ...
Kcnk12	Rat	Lynch syndrome 1		ISO	KCNK12 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Lynch syndrome 1	ClinVar
Kcnk12	Rat	Pitt-Hopkins-like syndrome 2		ISO	KCNK12 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pitt-Hopkins-like syndrome 2	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnk12	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of KCNK12 protein	CTD	PMID:32145629
Kcnk12	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[Testosterone co-treated with Estradiol] results in increased expression of KCNK12 mRNA	CTD	PMID:32741896
Kcnk12	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	Kcnk12 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Kcnk12	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2 more ...	CTD	PMID:27291303
Kcnk12	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	Kcnk12 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Kcnk12	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Kcnk12 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of KCNK12 mRNA	CTD	PMID:24680724
Kcnk12	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of KCNK12 mRNA	CTD	PMID:30047161
Kcnk12	Rat	aflatoxin B1	increases methylation	ISO	KCNK12 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of KCNK12 intron	CTD	PMID:30157460
Kcnk12	Rat	all-trans-retinoic acid	decreases expression	ISO	KCNK12 (Homo sapiens)	6480464	Tretinoin results in decreased expression of KCNK12 mRNA	CTD	PMID:21934132
Kcnk12	Rat	amiodarone	increases expression	ISO	KCNK12 (Homo sapiens)	6480464	Amiodarone results in increased expression of KCNK12 mRNA	CTD	PMID:19774075
Kcnk12	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of KCNK12 mRNA	CTD	PMID:30047161
Kcnk12	Rat	arsenous acid	increases expression	ISO	KCNK12 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of KCNK12 mRNA	CTD	PMID:20458559
Kcnk12	Rat	benzo[a]pyrene	affects methylation	ISO	KCNK12 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of KCNK12 promoter	CTD	PMID:27901495
Kcnk12	Rat	benzo[a]pyrene	increases methylation	ISO	KCNK12 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of KCNK12 3' UTR and Benzo(a)pyrene results in increased methylation of KCNK12 exon	CTD	PMID:27901495
Kcnk12	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of KCNK12 mRNA	CTD	PMID:25181051
Kcnk12	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of KCNK12 protein	CTD	PMID:32145629
Kcnk12	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of KCNK12 mRNA	CTD	PMID:33296240
Kcnk12	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of KCNK12 gene	CTD	PMID:28505145
Kcnk12	Rat	butanal	increases expression	ISO	KCNK12 (Homo sapiens)	6480464	butyraldehyde results in increased expression of KCNK12 mRNA	CTD	PMID:26079696
Kcnk12	Rat	cadmium atom	multiple interactions	ISO	Kcnk12 (Mus musculus)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of KCNK12 mRNA	CTD	PMID:37325564
Kcnk12	Rat	cadmium dichloride	multiple interactions	ISO	Kcnk12 (Mus musculus)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of KCNK12 mRNA	CTD	PMID:37325564
Kcnk12	Rat	carbamazepine	affects expression	ISO	KCNK12 (Homo sapiens)	6480464	Carbamazepine affects the expression of KCNK12 mRNA	CTD	PMID:25979313
Kcnk12	Rat	CGP 52608	multiple interactions	ISO	KCNK12 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to KCNK12 gene]	CTD	PMID:28238834
Kcnk12	Rat	choline	multiple interactions	ISO	Kcnk12 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of KCNK12 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of KCNK12 gene	CTD	PMID:20938992
Kcnk12	Rat	Cuprizon	affects expression	EXP		6480464	Cuprizone affects the expression of KCNK12 mRNA	CTD	PMID:26577399
Kcnk12	Rat	diarsenic trioxide	increases expression	ISO	KCNK12 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of KCNK12 mRNA	CTD	PMID:20458559
Kcnk12	Rat	dorsomorphin	multiple interactions	ISO	KCNK12 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KCNK12 mRNA	CTD	PMID:27188386
Kcnk12	Rat	flavonoids	increases expression	EXP		6480464	Flavonoids results in increased expression of KCNK12 mRNA	CTD	PMID:18035473
Kcnk12	Rat	folic acid	multiple interactions	ISO	Kcnk12 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of KCNK12 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of KCNK12 gene	CTD	PMID:20938992
Kcnk12	Rat	fonofos	increases methylation	ISO	KCNK12 (Homo sapiens)	6480464	Fonofos results in increased methylation of KCNK12 promoter	CTD	PMID:22847954
Kcnk12	Rat	FR900359	increases phosphorylation	ISO	KCNK12 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of KCNK12 protein	CTD	PMID:37730182
Kcnk12	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of KCNK12 mRNA	CTD	PMID:33387578
Kcnk12	Rat	L-methionine	multiple interactions	ISO	Kcnk12 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of KCNK12 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of KCNK12 gene	CTD	PMID:20938992
Kcnk12	Rat	maneb	multiple interactions	ISO	Kcnk12 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of KCNK12 mRNA	CTD	PMID:36117858
Kcnk12	Rat	manganese(II) chloride	decreases expression	EXP		6480464	manganese chloride results in decreased expression of KCNK12 mRNA	CTD	PMID:28801915
Kcnk12	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of KCNK12 mRNA	CTD	PMID:30047161
Kcnk12	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of KCNK12 gene	CTD	PMID:35440735
Kcnk12	Rat	N-methyl-4-phenylpyridinium	decreases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in decreased expression of KCNK12 mRNA	CTD	PMID:28801915
Kcnk12	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of KCNK12 mRNA	CTD	PMID:33387578
Kcnk12	Rat	paraquat	multiple interactions	ISO	Kcnk12 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of KCNK12 mRNA	CTD	PMID:36117858
Kcnk12	Rat	parathion	increases methylation	ISO	KCNK12 (Homo sapiens)	6480464	Parathion results in increased methylation of KCNK12 promoter	CTD	PMID:22847954
Kcnk12	Rat	PCB138	multiple interactions	ISO	Kcnk12 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Kcnk12	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	Kcnk12 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of KCNK12 mRNA	CTD	PMID:37995155
Kcnk12	Rat	phenylmercury acetate	decreases expression	ISO	KCNK12 (Homo sapiens)	6480464	Phenylmercuric Acetate results in decreased expression of KCNK12 mRNA	CTD	PMID:26272509
Kcnk12	Rat	phenylmercury acetate	multiple interactions	ISO	KCNK12 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KCNK12 mRNA	CTD	PMID:27188386
Kcnk12	Rat	resveratrol	multiple interactions	ISO	KCNK12 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of KCNK12 mRNA	CTD	PMID:23557933
Kcnk12	Rat	SB 431542	multiple interactions	ISO	KCNK12 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KCNK12 mRNA	CTD	PMID:27188386
Kcnk12	Rat	sodium arsenite	increases expression	ISO	Kcnk12 (Mus musculus)	6480464	sodium arsenite results in increased expression of KCNK12 mRNA	CTD	PMID:37682722
Kcnk12	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of KCNK12 mRNA	CTD	PMID:30047161
Kcnk12	Rat	terbufos	increases methylation	ISO	KCNK12 (Homo sapiens)	6480464	terbufos results in increased methylation of KCNK12 promoter	CTD	PMID:22847954
Kcnk12	Rat	testosterone	multiple interactions	EXP		6480464	[Testosterone co-treated with Estradiol] results in increased expression of KCNK12 mRNA	CTD	PMID:32741896
Kcnk12	Rat	thapsigargin	increases expression	ISO	KCNK12 (Homo sapiens)	6480464	Thapsigargin results in increased expression of KCNK12 mRNA	CTD	PMID:29453283
Kcnk12	Rat	titanium dioxide	increases methylation	ISO	Kcnk12 (Mus musculus)	6480464	titanium dioxide results in increased methylation of KCNK12 gene	CTD	PMID:35295148
Kcnk12	Rat	titanium dioxide	decreases methylation	ISO	Kcnk12 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of KCNK12 gene and titanium dioxide results in decreased methylation of KCNK12 promoter	CTD	PMID:35295148
Kcnk12	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of KCNK12 mRNA	CTD	PMID:33387578
Kcnk12	Rat	tunicamycin	increases expression	ISO	KCNK12 (Homo sapiens)	6480464	Tunicamycin results in increased expression of KCNK12 mRNA	CTD	PMID:22378314 and PMID:29453283
Kcnk12	Rat	valproic acid	increases expression	ISO	KCNK12 (Homo sapiens)	6480464	Valproic Acid results in increased expression of KCNK12 mRNA	CTD	PMID:24383497 and PMID:28001369
Kcnk12	Rat	valproic acid	increases methylation	ISO	KCNK12 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of KCNK12 gene	CTD	PMID:29154799
Kcnk12	Rat	valproic acid	affects expression	ISO	KCNK12 (Homo sapiens)	6480464	Valproic Acid affects the expression of KCNK12 mRNA	CTD	PMID:25979313

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnk12	Rat	monoatomic ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0407 and UniProtKB-KW:KW-0851	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnk12	Rat	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnk12	Rat	potassium ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0631	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnk12	Rat	potassium ion transmembrane transport	involved_in	IEA	InterPro:IPR003280 and InterPro:IPR005410	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnk12	Rat	potassium ion transmembrane transport	involved_in	IBA	FB:FBgn0017561 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnk12	Rat	potassium ion transport	involved_in	IEA	UniProtKB-KW:KW-0633	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnk12	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnk12	Rat	endoplasmic reticulum membrane	located_in	ISS	UniProtKB:Q9HB15	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Kcnk12	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kcnk12	Rat	endoplasmic reticulum membrane	located_in	ISO	KCNK12 (Homo sapiens)	1624291	PMID:24163367	RGD	PMID:24163367
Kcnk12	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB:Q9HB15 and ensembl:ENSP00000327611	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kcnk12	Rat	membrane	located_in	IEA	InterPro:IPR003280 and InterPro:IPR005410	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnk12	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnk12	Rat	monoatomic ion channel complex	part_of	IEA	UniProtKB-KW:KW-0851	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnk12	Rat	plasma membrane	located_in	ISO	KCNK12 (Homo sapiens)	1624291	PMID:25148687	RGD	PMID:25148687
Kcnk12	Rat	plasma membrane	located_in	IEA	UniProtKB:Q9HB15 and ensembl:ENSP00000327611	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kcnk12	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnk12	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kcnk12	Rat	plasma membrane	is_active_in	IBA	MGI:109322 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnk12	Rat	plasma membrane	located_in	ISS	UniProtKB:Q9HB15	1600115	GO_REF:0000024	UniProt	GO_REF:0000024

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnk12	Rat	identical protein binding	enables	IEA	UniProtKB:Q9HB15 and ensembl:ENSP00000327611	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kcnk12	Rat	identical protein binding	enables	ISO	KCNK12 (Homo sapiens)	1624291	PMID:25148687	RGD	PMID:25148687
Kcnk12	Rat	identical protein binding	enables	ISS	UniProtKB:Q9HB15	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Kcnk12	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnk12	Rat	outward rectifier potassium channel activity	enables	IBA	MGI:109366 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnk12	Rat	potassium channel activity	enables	ISO	KCNK12 (Homo sapiens)	1624291	PMID:25148687	RGD	PMID:25148687
Kcnk12	Rat	potassium channel activity	enables	IEA	UniProtKB-KW:KW-0631	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnk12	Rat	potassium channel activity	enables	IEA	InterPro:IPR003280 and InterPro:IPR005410	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnk12	Rat	potassium channel activity	enables	IEA	UniProtKB:Q9HB15 and ensembl:ENSP00000327611	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kcnk12	Rat	potassium ion leak channel activity	enables	IBA	FB:FBgn0017561 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnk12	Rat	protein binding	enables	ISO	KCNK12 (Homo sapiens)	1624291	UniProtKB:Q9HB14 and PMID:25148687	RGD	PMID:25148687
Kcnk12	Rat	protein heterodimerization activity	enables	ISO	KCNK12 (Homo sapiens)	1624291	PMID:25148687	RGD	PMID:25148687
Kcnk12	Rat	protein heterodimerization activity	enables	ISS	UniProtKB:Q9HB15	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Kcnk12	Rat	protein heterodimerization activity	enables	IEA	UniProtKB:Q9HB15 and ensembl:ENSP00000327611	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	Thik-1 and thik-2, a novel subfamily of tandem pore domain k+ channels.	Rajan S, etal., J Biol Chem 2001 Mar 9;276(10):7302-11.
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

PMID:18209473	PMID:24297522

Kcnk12
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	12,492,609 - 12,544,250 (+)	NCBI		GRCr8
mRatBN7.2	6	6,740,147 - 6,790,664 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	6,739,991 - 6,790,661 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	7,023,487 - 7,072,825 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	7,332,899 - 7,382,229 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	6,860,027 - 6,909,361 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	11,373,917 - 11,494,459 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	11,373,917 - 11,494,459 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	21,346,993 - 21,464,940 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	11,281,814 - 11,353,795 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	11,281,813 - 11,353,795 (-)	NCBI
Celera	6	6,499,476 - 6,548,106 (+)	NCBI		Celera
Cytogenetic Map	6	q12	NCBI

KCNK12
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	47,509,290 - 47,570,985 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	47,509,290 - 47,570,985 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	47,736,429 - 47,798,124 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	47,601,418 - 47,650,974 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	47,659,567 - 47,709,121	NCBI
Celera	2	47,586,584 - 47,636,146 (-)	NCBI		Celera
Cytogenetic Map	2	p16.3	NCBI
HuRef	2	47,483,265 - 47,533,353 (-)	NCBI		HuRef
CHM1_1	2	47,678,567 - 47,728,124 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	47,514,342 - 47,576,038 (-)	NCBI		T2T-CHM13v2.0

Kcnk12
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	88,049,100 - 88,106,329 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	88,053,229 - 88,105,422 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	87,745,821 - 87,797,994 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	87,745,801 - 87,797,994 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	88,145,161 - 88,197,334 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	87,654,147 - 87,706,320 (-)	NCBI		MGSCv36	mm8
Celera	17	92,153,722 - 92,202,711 (-)	NCBI		Celera
Cytogenetic Map	17	E4	NCBI
cM Map	17	57.87	NCBI

Kcnk12
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955441	14,270,030 - 14,281,639 (-)	NCBI	ChiLan1.0	ChiLan1.0

KCNK12
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	78,815,056 - 78,870,269 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	78,819,016 - 78,870,028 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	47,635,456 - 47,690,792 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	48,532,407 - 48,611,846 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

KCNK12
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	49,618,476 - 49,672,539 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	49,606,354 - 49,671,387 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	49,473,652 - 49,526,397 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	50,491,995 - 50,544,739 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	50,479,802 - 50,544,739 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	50,199,254 - 50,251,980 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	50,485,932 - 50,538,669 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	50,673,799 - 50,726,546 (-)	NCBI		UU_Cfam_GSD_1.0

Kcnk12
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	33,443,930 - 33,489,142 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936508	4,874,001 - 4,919,410 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936508	4,872,922 - 4,918,728 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KCNK12
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	92,990,021 - 93,041,533 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	92,990,129 - 93,044,989 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	98,959,636 - 99,014,555 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KCNK12
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	59,641,852 - 59,692,705 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	59,641,874 - 59,692,568 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	52,153,382 - 52,206,778 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kcnk12
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	28,889,241 - 28,935,936 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624738	28,892,710 - 28,935,876 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Kcnk12
221 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	62
Count of miRNA genes:	58
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000021570
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
1549905	Stresp10	Stress response QTL 10	6.83	0.0066	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	6	1	27574569	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
2293706	Bmd20	Bone mineral density QTL 20	4.3	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	5074497	19988050	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
738023	Alc17	Alcohol consumption QTL 17	3.1	0.003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	6	1	27574569	Rat
1354616	Despr12	Despair related QTL 12		0.0012	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	6	1	27574569	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
2300176	Bmd51	Bone mineral density QTL 51	11.7	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	6	1	27574569	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
2300190	Bmd52	Bone mineral density QTL 52	11.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	6	1	27574569	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	4	20	109	76	75	46	23	46	6	150	59	89	32	59	29


RefSeq Transcripts	NM_022292	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112873	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF287300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021570 ⟹ ENSRNOP00000021570

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	6,741,271 - 6,790,645 (+)	Ensembl
Rnor_6.0 Ensembl	6	11,373,917 - 11,494,459 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113759 ⟹ ENSRNOP00000084526

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	6,739,991 - 6,790,661 (+)	Ensembl

RefSeq Acc Id:

NM_022292 ⟹ NP_071628

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	12,494,850 - 12,544,221 (+)	NCBI
mRatBN7.2	6	6,741,271 - 6,790,645 (+)	NCBI
Rnor_6.0	6	11,373,917 - 11,494,459 (-)	NCBI
Rnor_5.0	6	21,346,993 - 21,464,940 (-)	NCBI
RGSC_v3.4	6	11,281,814 - 11,353,795 (-)	RGD
Celera	6	6,499,476 - 6,548,106 (+)	RGD

Sequence:

show sequence

CGCCTAGGCGCGACCGATCCCCAGTAGCCTCATGGGACGCTCCAGAGGACTCTCTCTGTGCCCTGCCACCGTGTTCCGATCCTAGGCGTCCGGACTCCACGGTTCACCCTGACCGCAACCCGCGGCCT
GTCCAGAGTGGAGTATGCGGCCCGGAGCCCCGTGGACTCCGGCCACCGGGCGGCGCTGGCCTAGCTTCGGAGCCCAGAGCCCGAGGGCAGCAAGTGAGGAGCCGCGAGAGGCAGTAAGGCGTCGGGGC
GCGGAGAGAAGCCGCTCCAAGCCGGGTGTCCACTGGGCCGGGTGACCGGTGGGTGGCCTGAACGCCGGGCAGGAGGCGGATCGCCCTGCCGTCCCGGTTCCGGGGAGACTGCAGAGGGGCTCCGCCGC
AGCCCCTGTCTTCTGGCCACCATCCTCACGCTCCTGCTCCTGCGGCGGGGATGTCACGGCCCCGGCTCCGAGCGCCGTCCCAGCCCCGGGGCTGAGCTGCGGACCATGTCCTCCCGCAGCCCCCGGCC
CCCGCCCCGCCGCTGCCGCCGCCGCCTGCCGCGCCCCTCCTGCTGCTGCTGCTGCTGCCGCCGCTCGCACCTCAACGAGGACACCGGACGCTTCGTGCTGCTGGCCGCGCTCATTGGCCTCTACCTGG
TGGCCGGCGCCACCGTCTTCTCCGCGCTCGAGAGCCCGGGCGAGGCGGAGGCGCGGGCGCGCTGGGGCGCCACGCTGCGCAACTTCAGCGCTGCGCACGGCGTCGCGGAGCCGGAGCTGCGCGCCTTC
CTCCGGCACTACGAGGCCGCGCTGGCCGCCGGGGTCCGCGCCGACGCGCTGCGCCCGCGCTGGGACTTCCCTGGAGCCTTCTACTTCGTGGGCACCGTGGTGTCGACCATAGGCTTCGGCATGACCAC
CCCAGCCACAGTGGGCGGGAAGGCCTTCCTCATCGCCTACGGACTGTTCGGCTGCGCGGGGACCATCCTGTTCTTCAACCTCTTTCTGGAGCGCATCATCTCGCTGCTGGCCTTCATCATGCGCGCCT
GCCGGGAGCGTCAGCTGCGCCGCAGTGGCCTGCTGCCCGCCACCTTCCGCCGAGGCTCGGCGCTGTCGGAGGCCGACAGCCTGGCGGGCTGGAAGCCCTCGGTGTATCACGTGCTGCTCATCCTGGGC
CTGTTCGCCGTGCTGCTGGCCTGCTGCGCCTCGGCCATGTACACCAGCGTGGAGGGCTGGGACTACGTGGACTCGCTCTACTTCTGCTTCGTCACCTTCAGCACCATCGGCTTCGGGGACCTGGTGAG
CAGCCAGCACGCCGCCTACCGGAACCAGGGGCTCTACCGTCTGGGCAACTTCCTTTTCATCCTGCTCGGCGTGTGCTGCATCTACTCGCTCTTCAACGTCATCTCCATCCTCATCAAGCAGGTGCTCA
ACTGGATGCTGCGCAAGCTGAGCTGCCGCTGCTGCACGCGCTGCTGCCCGGCTCCCGGCGCGCCCCTGTCCCGGCGCAACGCCATCACCCCGGGCTCCCGGCTGCGCCGTCGCCTGGCCGCGCTGGGT
ACCGACCCCGCGGCTCGCGACAGCGACGCCGAGGGCCGCCGCCTGTCGGGAGAGCTCATCTCAATGCGCGACCTCACGGCGTCCAACAAGGTGTCGCTGGCACTGCTGCAGAAGCAGCTTTCCGAGAC
GGCCAACGGCTACCCGCGCAGCGTGTGCGTCAACACGCGCCAGAACGGCTTCTCGGGCGGCGTGGGCGCGCTGGGCATCATGAACAACCGGCTGGCAGAGACCAGCGCCTCCAGGTAGAGCGGCCGCC
CGCCCCCAGCGCCGCGGACCTGGCCGGGGCTGCGCGCCGCCGGGCGGGTTTGCTTCACTTCTCTCCGAGATGGCGCTTTCTTAATCTTTATCCAATAAAACTCGTGCC

hide sequence

RefSeq Acc Id:

XM_039112871 ⟹ XP_038968799

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	12,492,609 - 12,544,250 (+)	NCBI
mRatBN7.2	6	6,740,160 - 6,790,664 (+)	NCBI

RefSeq Acc Id:

XM_039112873 ⟹ XP_038968801

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	12,542,311 - 12,544,250 (+)	NCBI
mRatBN7.2	6	6,788,139 - 6,790,664 (+)	NCBI


Protein RefSeqs	NP_071628	(Get FASTA)	NCBI Sequence Viewer
	XP_038968799	(Get FASTA)	NCBI Sequence Viewer
	XP_038968801	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG32311	(Get FASTA)	NCBI Sequence Viewer
	EDM02633	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021570
	ENSRNOP00000021570.1
GenBank Protein	Q9ERS1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071628 ⟸ NM_022292

- UniProtKB:

Q9ERS1 (UniProtKB/Swiss-Prot), A6H9C8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSRSPRPPPRRCRRRLPRPSCCCCCCRRSHLNEDTGRFVLLAALIGLYLVAGATVFSALESPGEAEARARWGATLRNFSAAHGVAEPELRAFLRHYEAALAAGVRADALRPRWDFPGAFYFVGTVVS
TIGFGMTTPATVGGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYHVLLILGLFAVLLACCASAMYTSVEGWDYVDSLYFCFVTFST
IGFGDLVSSQHAAYRNQGLYRLGNFLFILLGVCCIYSLFNVISILIKQVLNWMLRKLSCRCCTRCCPAPGAPLSRRNAITPGSRLRRRLAALGTDPAARDSDAEGRRLSGELISMRDLTASNKVSLAL
LQKQLSETANGYPRSVCVNTRQNGFSGGVGALGIMNNRLAETSASR

hide sequence

Ensembl Acc Id:

ENSRNOP00000021570 ⟸ ENSRNOT00000021570

RefSeq Acc Id:	XP_038968799 ⟸ XM_039112871
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZZT0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038968801 ⟸ XM_039112873
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000084526 ⟸ ENSRNOT00000113759

Protein Domains

Potassium channel

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9ERS1-F1-model_v2	AlphaFold	Q9ERS1	1-430	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13694397

Promoter ID:

EPDNEW_R4922

Type:

initiation region

Name:

Kcnk12_1

Description:

potassium two pore domain channel subfamily K member 12

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	11,494,534 - 11,494,594	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-38748	BioCyc
Ensembl Genes	ENSRNOG00000016110	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000021570	ENTREZGENE
	ENSRNOT00000021570.3	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.287.70	UniProtKB/Swiss-Prot
InterPro	2pore_dom_K_chnl	UniProtKB/Swiss-Prot
	2pore_dom_K_chnl_THIK	UniProtKB/Swiss-Prot
	K_chnl_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:64119	UniProtKB/Swiss-Prot
NCBI Gene	64119	ENTREZGENE
PANTHER	POTASSIUM CHANNEL SUBFAMILY K MEMBER 12	UniProtKB/Swiss-Prot
	PTHR11003	UniProtKB/Swiss-Prot
Pfam	Ion_trans_2	UniProtKB/Swiss-Prot
PhenoGen	Kcnk12	PhenoGen
PRINTS	2POREKCHANEL	UniProtKB/Swiss-Prot
	THIKCHANNEL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016110	RatGTEx
Superfamily-SCOP	Voltage-gated potassium channels	UniProtKB/Swiss-Prot
TIGR	TC235238
UniProt	A0A8I5ZZT0	ENTREZGENE, UniProtKB/TrEMBL
	A6H9C8	ENTREZGENE, UniProtKB/TrEMBL
	KCNKC_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Kcnk12	potassium two pore domain channel subfamily K member 12	Kcnk12	potassium channel, two pore domain subfamily K, member 12	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-01-26	Kcnk12	potassium channel, two pore domain subfamily K, member 12	Kcnk12	potassium channel, subfamily K, member 12	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Kcnk12	potassium channel, subfamily K, member 12			Symbol and Name status set to approved	70586	APPROVED

Note Type	Note	Reference
gene_expression	abundant in brain; expressed in kidney, stomach, liver, and some non-neuronal cells such as the ependymal lining of the ventricles	67928

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar