Advanced Search (OLGA)

Gene: Pigbos1 (PIGB opposite strand 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Pigbos1

Name:

PIGB opposite strand 1

RGD ID:

6502569

Description:

Predicted to be involved in regulation of endoplasmic reticulum unfolded protein response. Located in mitochondrial outer membrane. Orthologous to human PIGBOS1 (PIGB opposite strand 1); INTERACTS WITH bisphenol A; triphenyl phosphate; 2-hydroxypropanoic acid (ortholog).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC100909598; PIGB opposite strand protein 1 homolog; uncharacterized LOC100909598; uncharacterized protein LOC100909598

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PIGBOS1 (PIGB opposite strand 1)	RGD	RGD
Mus musculus (house mouse):	Pigbos1 (Pigb opposite strand 1)	RGD	RGD
Pan paniscus (bonobo/pygmy chimpanzee):	PIGBOS1 (PIGB opposite strand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PIGBOS1 (PIGB opposite strand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pigbos1 (PIGB opposite strand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PIGBOS1 (PIGB opposite strand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PIGBOS1 (PIGB opposite strand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pigbos1 (PIGB opposite strand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Pigbos1 (Pigb opposite strand 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PIGBOS1 (PIGB opposite strand 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	82,656,376 - 82,660,745 (+)	NCBI		GRCr8
mRatBN7.2	8	73,775,732 - 73,780,102 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	73,775,732 - 73,780,102 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	79,299,048 - 79,303,405 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	77,571,656 - 77,576,013 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	75,409,007 - 75,413,364 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	79,715,337 - 79,719,706 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	8	73,370,273 - 73,373,883 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	8	67,975,369 - 67,979,746 (-)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigbos1	Rat	2-hydroxypropanoic acid	decreases expression	ISO	PIGBOS1 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of PIGBOS1 mRNA	CTD	PMID:30851411
Pigbos1	Rat	aristolochic acid A	decreases expression	ISO	PIGBOS1 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of PIGBOS1 mRNA	CTD	PMID:33212167
Pigbos1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PIGBOS1 mRNA	CTD	PMID:34947998
Pigbos1	Rat	bisphenol A	increases expression	ISO	Pigbos1 (Mus musculus)	6480464	bisphenol A results in increased expression of PIGBOS1 mRNA	CTD	PMID:38074096
Pigbos1	Rat	cadmium dichloride	decreases expression	ISO	PIGBOS1 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of PIGBOS1 mRNA	CTD	PMID:38568856
Pigbos1	Rat	corosolic acid	decreases expression	ISO	PIGBOS1 (Homo sapiens)	6480464	corosolic acid results in decreased expression of PIGBOS1 mRNA	CTD	PMID:37939859
Pigbos1	Rat	crocidolite asbestos	decreases expression	ISO	Pigbos1 (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of PIGBOS1 mRNA	CTD	PMID:29279043
Pigbos1	Rat	Dibutyl phosphate	affects expression	ISO	PIGBOS1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of PIGBOS1 mRNA	CTD	PMID:37042841
Pigbos1	Rat	doxorubicin	increases expression	ISO	PIGBOS1 (Homo sapiens)	6480464	Doxorubicin results in increased expression of PIGBOS1 mRNA	CTD	PMID:29803840
Pigbos1	Rat	rac-lactic acid	decreases expression	ISO	PIGBOS1 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of PIGBOS1 mRNA	CTD	PMID:30851411
Pigbos1	Rat	tetrachloromethane	decreases expression	ISO	Pigbos1 (Mus musculus)	6480464	Carbon Tetrachloride results in decreased expression of PIGBOS1 mRNA	CTD	PMID:31919559
Pigbos1	Rat	triphenyl phosphate	increases expression	EXP		6480464	triphenyl phosphate results in increased expression of PIGBOS1 mRNA	CTD	PMID:30589522

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigbos1	Rat	regulation of endoplasmic reticulum unfolded protein response	involved_in	ISS	UniProtKB:A0A0B4J2F0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Pigbos1	Rat	regulation of endoplasmic reticulum unfolded protein response	involved_in	IEA	UniProtKB:A0A0B4J2F0 and ensembl:ENSP00000484893	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pigbos1	Rat	regulation of endoplasmic reticulum unfolded protein response	involved_in	ISO	PIGBOS1 (Homo sapiens)	1624291	PMID:31653868	RGD	PMID:31653868
Pigbos1	Rat	response to unfolded protein	involved_in	IEA	UniProtKB-KW:KW-0834	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigbos1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pigbos1	Rat	mitochondrial outer membrane	located_in	ISO	PIGBOS1 (Homo sapiens)	1624291	PMID:31653868	RGD	PMID:31653868
Pigbos1	Rat	mitochondrial outer membrane	located_in	IEA	UniProtKB:A0A0B4J2F0 and ensembl:ENSP00000484893	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pigbos1	Rat	mitochondrial outer membrane	located_in	IEA	UniProtKB-SubCell:SL-0172	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pigbos1	Rat	mitochondrial outer membrane	located_in	IEA	UniProtKB-KW:KW-1000	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pigbos1	Rat	mitochondrial outer membrane	located_in	IDA		21201253	PMID:31653868	UniProt
Pigbos1	Rat	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigbos1	Rat	protein binding	enables	ISO	PIGBOS1 (Homo sapiens)	1624291	UniProtKB:Q96S66 and PMID:31653868	RGD	PMID:31653868

#	Reference Title	Reference Citation
1.	Regulation of the ER stress response by a mitochondrial microprotein.	Chu Q, etal., Nat Commun. 2019 Oct 25;10(1):4883. doi: 10.1038/s41467-019-12816-z.

PMID:34800366

Pigbos1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	82,656,376 - 82,660,745 (+)	NCBI		GRCr8
mRatBN7.2	8	73,775,732 - 73,780,102 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	73,775,732 - 73,780,102 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	79,299,048 - 79,303,405 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	77,571,656 - 77,576,013 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	75,409,007 - 75,413,364 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	79,715,337 - 79,719,706 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	8	73,370,273 - 73,373,883 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	8	67,975,369 - 67,979,746 (-)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

PIGBOS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	55,317,184 - 55,319,123 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	55,317,184 - 55,319,161 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	55,609,382 - 55,611,321 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Cytogenetic Map	15	q21.3	NCBI
HuRef	15	32,435,319 - 32,437,272 (-)	NCBI		HuRef
CHM1_1	15	55,727,850 - 55,729,854 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	53,120,373 - 53,122,312 (-)	NCBI		T2T-CHM13v2.0

Pigbos1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	72,947,000 - 72,950,064 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	72,947,000 - 72,950,061 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	73,039,718 - 73,042,782 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	73,039,718 - 73,042,779 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	72,887,522 - 72,890,582 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
Celera	9	70,225,950 - 70,229,009 (+)	NCBI		Celera
Cytogenetic Map	9	D	NCBI
cM Map	9	40.08	NCBI

PIGBOS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	44,579,608 - 44,618,576 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	48,762,432 - 48,801,696 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	34,286,568 - 34,325,835 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	52,609,721 - 52,611,705 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	52,610,151 - 52,610,315 (-)	Ensembl	panpan1.1		panPan2

PIGBOS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	20,716,509 - 20,718,608 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	20,680,878 - 20,683,534 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	20,865,474 - 20,868,145 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	30	20,809,331 - 20,811,991 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	20,893,388 - 20,896,057 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	21,025,157 - 21,027,833 (-)	NCBI		UU_Cfam_GSD_1.0

Pigbos1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	98,978,831 - 98,980,853 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936471	16,827,097 - 16,829,005 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PIGBOS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	116,522,226 - 116,522,390 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	116,519,834 - 116,522,515 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	129,056,601 - 129,060,650 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PIGBOS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	28,115,884 - 28,120,997 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	113,147,162 - 113,155,289 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pigbos1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624731	6,304,962 - 6,307,303 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Pigbos1
8 total Variants

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat

RH131439

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	73,779,044 - 73,779,257 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	79,718,649 - 79,718,861	NCBI	Rnor6.0
Rnor_5.0	8	73,370,335 - 73,370,547	UniSTS	Rnor5.0
RGSC_v3.4	8	77,795,145 - 77,795,357	UniSTS	RGSC3.4
Celera	8	67,976,214 - 67,976,426	UniSTS
Cytogenetic Map	8	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001308432	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC142458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB765491	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000108954 ⟹ ENSRNOP00000094136

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	73,775,732 - 73,780,102 (+)	Ensembl

RefSeq Acc Id:

NM_001308432 ⟹ NP_001295361

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	82,656,376 - 82,660,745 (+)	NCBI
mRatBN7.2	8	73,775,732 - 73,780,102 (+)	NCBI
Rnor_6.0	8	79,715,337 - 79,719,706 (+)	NCBI
Celera	8	67,975,369 - 67,979,746 (-)	NCBI

Sequence:

show sequence

AGGAGCAAATCTTCCTGACTGGAGTTCAGTGCTGGAAAAGACAAAAAAATAAAGACTCTGGATGCTTTACTGCGCCTGACACCTCGCACAGCGCCCGCTGAGGAGGCGCTCGGAGTTCTGAAGAGATT
TGCTGTCTGTGGAACCTAGTCACGCTCAGCTGTGCGCCACTCGCCGTAGCAATGCTCCGGAGATTGACGCGTCCACAACTGCTTTTTGCTGCCGCCCTTGGAGTTGCTGGAGGAATGTATATTTATCA
ACCAATATTTGAACAGTATTCCAGAGATCAGAAGGAATTAAAAGAAAAGGTGAAAATTTTGCAAGAATCAGAAGAAAAGAGGAGCTAATTCTGCATAAACTGAAATTGTTTTCATTGCTTAAAGTCCT
GTTGACATCACACATGGACTATTAATCTAGCAAGAATTTAGTGTGTTTTAAATAAATCATGGGTAATGGATCTAAGTTATTTATGGATGTAATTCTTCATTGGTTTGTTTTGGGGCAAGAACTCACTA
TGTAGCACAGGCTGGCCCCAAGCTCTAAGCTGTCCAACCATAACTTTCTTTCTAGCATTTGTTTTTTTAGACAGGATCTGTCTCTGTGGCCAATGCTGGCTTCAAACATGCAATCCTGCCACTGGTGG
GATTAGAGAGTATCACCATATCTAGCTCAGAATGAGATGCTTCATTTTTAAAAATACTTTTTAGTTATATGTAATTGTGTGTGCACTTCTTGTGGTTTATGTACATGTGAGTGCAAGTGCTTGTGAGG
CCAAAGTTGTCTTCTAGAGCCGGAGTCACAGATGGTTGTGAGCTGCCATGCGGGTCCTAGGAACTAAATCCTAGGTCCTCTTCGAGAGCAACGAGCTCTTAAGTGTGGAGCCATTTCTGCAGCCCCGA
CGTGTTCACGTTAATATTCACTCATGCATTCGCTATCTCGTGTCTTCTTTTCAGAGTAGGGCAAAAATTTCCTACTGCATAAATTAATTTAGCATGTTTAACAATTAGTGTGTACTTTTAAGATTCCC
CTTTTTGAGCTGGAGAGATGGCTCAGCAGTTAAGAGCACTGTCTGCTCTTTCAGAGGTCCTGAGTTCAATTCCCAGCACCCAATTGATGGCTTATAACCATCTGTAACTGTAGTCCCATGGTGATCTC
CCCTGGTATGCAGGTTCATGCAGACAAAACATTCATATACATAAAATAATTTTTAATTCCCTCTACCATGTACAATAAAACCACACAAATGTGA

hide sequence


Protein RefSeqs	NP_001295361	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	C0HLN0	(Get FASTA)	NCBI Sequence Viewer
	EDL84111	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000094136
	ENSRNOP00000094136.1

RefSeq Acc Id:	NP_001295361 ⟸ NM_001308432
- UniProtKB:	C0HLN0 (UniProtKB/Swiss-Prot), A6KEL0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLRRLTRPQLLFAAALGVAGGMYIYQPIFEQYSRDQKELKEKVKILQESEEKRS hide sequence

Ensembl Acc Id:

ENSRNOP00000094136 ⟸ ENSRNOT00000108954

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-C0HLN0-F1-model_v2	AlphaFold	C0HLN0	1-54	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-29853	BioCyc
Ensembl Genes	ENSRNOG00000067122	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000108954	ENTREZGENE
	ENSRNOT00000108954.1	UniProtKB/Swiss-Prot
KEGG Report	rno:100909598	UniProtKB/Swiss-Prot
NCBI Gene	LOC100909598	ENTREZGENE
PhenoGen	Pigbos1	PhenoGen
RatGTEx	ENSRNOG00000067122	RatGTEx
UniProt	A6KEL0	ENTREZGENE, UniProtKB/TrEMBL
	C0HLN0	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-05-05	Pigbos1	PIGB opposite strand 1	LOC100909598	uncharacterized LOC100909598	Name and Symbol changed; type changed from [ncrna] to [protein-coding]	629549	APPROVED
2012-07-05	LOC100909598	uncharacterized LOC100909598			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message