Symbol:
Tsnax
Name:
translin-associated factor X
RGD ID:
621574
Description:
Enables A2A adenosine receptor binding activity. Contributes to sequence-specific DNA binding activity and single-stranded DNA binding activity. Predicted to be involved in siRNA processing. Predicted to be located in Golgi apparatus and nucleoplasm. Predicted to be part of endoribonuclease complex. Predicted to be active in cytoplasm and nucleus. Orthologous to human TSNAX (translin associated factor X); INTERACTS WITH androgen antagonist; bisphenol A; Butylparaben.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC93125; translin-associated protein X; Trax
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 69,873,210 - 69,887,244 (+) NCBI GRCr8 mRatBN7.2 19 52,975,848 - 52,989,886 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 52,975,659 - 52,989,878 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 59,760,714 - 59,774,744 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 60,611,752 - 60,625,774 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 62,687,176 - 62,701,202 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 57,771,539 - 57,785,567 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 57,771,398 - 57,785,543 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 68,481,972 - 68,496,000 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 19 52,341,840 - 52,355,838 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tsnax Rat 1,2-dimethylhydrazine multiple interactions ISO Tsnax (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of TSNAX mRNA CTD PMID:22206623 Tsnax Rat 17beta-estradiol increases expression ISO Tsnax (Mus musculus) 6480464 Estradiol results in increased expression of TSNAX mRNA CTD PMID:39298647 Tsnax Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tsnax (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TSNAX mRNA CTD PMID:16962184 Tsnax Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tsnax (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TSNAX mRNA CTD PMID:24680724 Tsnax Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO TSNAX (Homo sapiens) 6480464 3 more ... CTD PMID:19692669 Tsnax Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TSNAX (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TSNAX mRNA CTD PMID:28628672 Tsnax Rat 4,4'-sulfonyldiphenol increases expression ISO Tsnax (Mus musculus) 6480464 bisphenol S results in increased expression of TSNAX mRNA CTD PMID:39298647 Tsnax Rat 4,4'-sulfonyldiphenol increases expression ISO TSNAX (Homo sapiens) 6480464 bisphenol S results in increased expression of TSNAX protein CTD PMID:34186270 Tsnax Rat acetylsalicylic acid increases expression ISO TSNAX (Homo sapiens) 6480464 Aspirin results in increased expression of TSNAX mRNA CTD PMID:11906190 Tsnax Rat androgen antagonist multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of TSNAX mRNA CTD PMID:25607892 Tsnax Rat arsane multiple interactions ISO TSNAX (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TSNAX mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TSNAX mRNA CTD PMID:39836092 Tsnax Rat arsenic atom multiple interactions ISO TSNAX (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TSNAX mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TSNAX mRNA CTD PMID:39836092 Tsnax Rat arsenite(3-) increases expression ISO Tsnax (Mus musculus) 6480464 arsenite results in increased expression of TSNAX protein CTD PMID:37955338 Tsnax Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of TSNAX mRNA CTD PMID:25607892 Tsnax Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TSNAX mRNA CTD PMID:34947998 Tsnax Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TSNAX gene CTD PMID:28505145 Tsnax Rat bisphenol A affects methylation ISO Tsnax (Mus musculus) 6480464 bisphenol A affects the methylation of TSNAX promoter CTD PMID:27334623 Tsnax Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TSNAX mRNA CTD PMID:25181051 Tsnax Rat bisphenol F multiple interactions ISO TSNAX (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of TSNAX gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TSNAX mRNA CTD PMID:28628672 and PMID:31601247 Tsnax Rat butanal increases expression ISO TSNAX (Homo sapiens) 6480464 butyraldehyde results in increased expression of TSNAX mRNA CTD PMID:26079696 Tsnax Rat Butylparaben multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of TSNAX mRNA CTD PMID:25607892 Tsnax Rat cadmium atom multiple interactions ISO TSNAX (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TSNAX mRNA CTD PMID:35301059 Tsnax Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of TSNAX mRNA CTD PMID:33453195 Tsnax Rat cadmium dichloride multiple interactions ISO TSNAX (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TSNAX mRNA CTD PMID:35301059 Tsnax Rat choline multiple interactions ISO Tsnax (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of TSNAX gene CTD PMID:20938992 Tsnax Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of TSNAX protein CTD PMID:16470657 Tsnax Rat copper atom multiple interactions ISO TSNAX (Homo sapiens) 6480464 [Thiosemicarbazones binds to Copper] which results in increased expression of TSNAX protein CTD PMID:20931265 Tsnax Rat copper(0) multiple interactions ISO TSNAX (Homo sapiens) 6480464 [Thiosemicarbazones binds to Copper] which results in increased expression of TSNAX protein CTD PMID:20931265 Tsnax Rat crocidolite asbestos increases expression ISO TSNAX (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of TSNAX mRNA CTD PMID:29523930 Tsnax Rat cyclosporin A decreases expression ISO TSNAX (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TSNAX mRNA CTD PMID:25562108 Tsnax Rat dexamethasone multiple interactions ISO TSNAX (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TSNAX mRNA CTD PMID:28628672 Tsnax Rat dextran sulfate decreases expression ISO Tsnax (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of TSNAX protein CTD PMID:32272095 Tsnax Rat dextran sulfate multiple interactions ISO Tsnax (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of TSNAX protein] CTD PMID:32272095 Tsnax Rat dicrotophos decreases expression ISO TSNAX (Homo sapiens) 6480464 dicrotophos results in decreased expression of TSNAX mRNA CTD PMID:28302478 Tsnax Rat enzacamene multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of TSNAX mRNA CTD PMID:25607892 Tsnax Rat ethanol multiple interactions ISO Tsnax (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of TSNAX mRNA CTD PMID:30319688 Tsnax Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of TSNAX mRNA CTD PMID:24136188 Tsnax Rat folic acid multiple interactions ISO Tsnax (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Tsnax Rat fulvestrant multiple interactions ISO TSNAX (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of TSNAX gene CTD PMID:31601247 Tsnax Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TSNAX mRNA CTD PMID:22061828 Tsnax Rat indometacin multiple interactions ISO TSNAX (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TSNAX mRNA CTD PMID:28628672 Tsnax Rat ivermectin decreases expression ISO TSNAX (Homo sapiens) 6480464 Ivermectin results in decreased expression of TSNAX protein CTD PMID:32959892 Tsnax Rat L-methionine multiple interactions ISO Tsnax (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of TSNAX gene CTD PMID:20938992 Tsnax Rat manganese atom multiple interactions ISO TSNAX (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TSNAX mRNA CTD PMID:39836092 Tsnax Rat manganese(0) multiple interactions ISO TSNAX (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TSNAX mRNA CTD PMID:39836092 Tsnax Rat manganese(II) chloride multiple interactions ISO TSNAX (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TSNAX mRNA CTD PMID:39836092 Tsnax Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of TSNAX mRNA CTD PMID:24136188 Tsnax Rat nickel atom decreases expression ISO TSNAX (Homo sapiens) 6480464 Nickel results in decreased expression of TSNAX mRNA CTD PMID:23195993 Tsnax Rat nitrates multiple interactions ISO Tsnax (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TSNAX mRNA CTD PMID:35964746 Tsnax Rat ochratoxin A multiple interactions ISO TSNAX (Homo sapiens) 6480464 [ochratoxin A results in decreased acetylation of TSNAX promoter] which results in decreased expression of TSNAX mRNA CTD PMID:29098329 Tsnax Rat ochratoxin A decreases acetylation ISO TSNAX (Homo sapiens) 6480464 ochratoxin A results in decreased acetylation of TSNAX promoter CTD PMID:29098329 Tsnax Rat ochratoxin A decreases expression ISO TSNAX (Homo sapiens) 6480464 ochratoxin A results in decreased expression of TSNAX mRNA CTD PMID:29098329 Tsnax Rat paclitaxel increases expression EXP 6480464 Paclitaxel analog results in increased expression of TSNAX mRNA and Paclitaxel results in increased expression of TSNAX mRNA CTD PMID:15585946 Tsnax Rat paracetamol multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of TSNAX mRNA CTD PMID:25607892 Tsnax Rat SB 431542 multiple interactions ISO TSNAX (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of TSNAX protein CTD PMID:37664457 Tsnax Rat sodium arsenite multiple interactions ISO TSNAX (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TSNAX mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TSNAX mRNA CTD PMID:39836092 Tsnax Rat sulindac decreases expression ISO TSNAX (Homo sapiens) 6480464 Sulindac results in decreased expression of TSNAX mRNA CTD PMID:11906190 Tsnax Rat tetrahydropalmatine decreases expression ISO TSNAX (Homo sapiens) 6480464 tetrahydropalmatine results in decreased expression of TSNAX protein CTD PMID:20109541 Tsnax Rat titanium dioxide decreases methylation ISO Tsnax (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TSNAX promoter CTD PMID:35295148 Tsnax Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of TSNAX gene CTD PMID:31079544
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) acetylsalicylic acid (ISO) androgen antagonist (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) Butylparaben (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) choline (ISO) clofibrate (EXP) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dexamethasone (ISO) dextran sulfate (ISO) dicrotophos (ISO) enzacamene (EXP) ethanol (ISO) flutamide (EXP) folic acid (ISO) fulvestrant (ISO) gentamycin (EXP) indometacin (ISO) ivermectin (ISO) L-methionine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) nefazodone (EXP) nickel atom (ISO) nitrates (ISO) ochratoxin A (ISO) paclitaxel (EXP) paracetamol (EXP) SB 431542 (ISO) sodium arsenite (ISO) sulindac (ISO) tetrahydropalmatine (ISO) titanium dioxide (ISO) vinclozolin (EXP)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
3.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.
GOA pipeline
RGD automated data pipeline
5.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
6.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
7.
Rescue of p53 blockage by the A(2A) adenosine receptor via a novel interacting protein, translin-associated protein X.
Sun CN, etal., Mol Pharmacol. 2006 Aug;70(2):454-66. Epub 2006 Apr 14.
8.
Identification of translin and trax as components of the GS1 strand-specific DNA binding complex enriched in brain.
Taira E, etal., J Neurochem 1998 Aug;71(2):471-7.
Tsnax Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 69,873,210 - 69,887,244 (+) NCBI GRCr8 mRatBN7.2 19 52,975,848 - 52,989,886 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 52,975,659 - 52,989,878 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 59,760,714 - 59,774,744 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 60,611,752 - 60,625,774 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 62,687,176 - 62,701,202 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 57,771,539 - 57,785,567 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 57,771,398 - 57,785,543 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 68,481,972 - 68,496,000 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 19 52,341,840 - 52,355,838 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
TSNAX Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 231,528,669 - 231,566,524 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 231,528,541 - 231,566,524 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 231,664,415 - 231,702,270 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 229,731,022 - 229,768,893 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 227,971,133 - 228,009,002 NCBI Celera 1 204,929,252 - 204,967,140 (+) NCBI Celera Cytogenetic Map 1 q42.2 NCBI HuRef 1 202,147,602 - 202,185,556 (+) NCBI HuRef CHM1_1 1 232,938,278 - 232,976,134 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 230,911,903 - 230,949,724 (+) NCBI T2T-CHM13v2.0
Tsnax Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 125,739,780 - 125,760,947 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 125,739,736 - 125,760,931 (+) Ensembl GRCm39 Ensembl GRCm38 8 125,013,041 - 125,034,208 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 125,012,997 - 125,034,192 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 127,536,897 - 127,558,092 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 127,899,087 - 127,920,282 (+) NCBI MGSCv36 mm8 Celera 8 129,326,694 - 129,341,575 (+) NCBI Celera Cytogenetic Map 8 E2 NCBI cM Map 8 73.1 NCBI
Tsnax Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955492 7,306,364 - 7,335,282 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955492 7,304,982 - 7,335,512 (-) NCBI ChiLan1.0 ChiLan1.0
TSNAX Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 17,635,061 - 17,673,619 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 17,830,925 - 17,869,486 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 207,082,890 - 207,120,706 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 212,104,927 - 212,142,691 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 212,104,927 - 212,142,691 (+) Ensembl panpan1.1 panPan2
TSNAX Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 7,937,622 - 7,968,014 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 7,937,820 - 7,967,889 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 7,929,606 - 7,960,377 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 7,961,738 - 7,992,266 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 7,959,001 - 7,992,287 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 7,966,680 - 7,997,444 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 8,086,896 - 8,117,465 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 8,314,660 - 8,345,183 (-) NCBI UU_Cfam_GSD_1.0
Tsnax Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 43,115,393 - 43,135,689 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936484 19,280,470 - 19,300,944 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936484 19,281,493 - 19,300,915 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TSNAX Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 59,024,034 - 59,058,308 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 59,027,295 - 59,058,300 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 63,573,296 - 63,604,624 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TSNAX Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 68,787,717 - 68,826,751 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 68,787,705 - 68,827,464 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 70,698,475 - 70,737,601 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tsnax
.
Predicted Target Of
Count of predictions: 1021 Count of miRNA genes: 339 Interacting mature miRNAs: 458 Transcripts: ENSRNOT00000071827 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
2313395 Anxrr26 Anxiety related response QTL 26 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 19 49976481 53225766 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 5135224 Leukc1 Leukocyte quantity QTL 1 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 19 44340214 55283277 Rat 724546 Kidm3 Kidney mass QTL 3 3.1 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 19 29322490 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 1358200 Insglur2 Insulin/glucose ratio QTL 2 4.1 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 19 33838214 55283146 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat
BE111581
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 52,986,150 - 52,986,319 (+) MAPPER mRatBN7.2 Rnor_6.0 19 57,781,832 - 57,782,000 NCBI Rnor6.0 Rnor_5.0 19 68,492,265 - 68,492,433 UniSTS Rnor5.0 Celera 19 52,352,103 - 52,352,271 UniSTS RH 3.4 Map 19 720.7 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000071827 ⟹ ENSRNOP00000063911
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 52,975,659 - 52,989,878 (+) Ensembl Rnor_6.0 Ensembl 19 57,771,398 - 57,785,543 (+) Ensembl
RefSeq Acc Id:
NM_022262 ⟹ NP_071598
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,873,210 - 69,887,244 (+) NCBI mRatBN7.2 19 52,975,848 - 52,989,886 (+) NCBI Rnor_6.0 19 57,771,539 - 57,785,567 (+) NCBI Rnor_5.0 19 68,481,972 - 68,496,000 (+) NCBI Celera 19 52,341,840 - 52,355,838 (+) RGD
Sequence:
CGCAGTGTCTGGCGACGGCCTTTTGCTGAGCTGACCCGGCGGCTGCGGTTCCTGCGCTTGCAAACCGAGGCCCCGCGGTCATGAACGGCAAAGAGGGACCAGGAGGGTTCAGGAAGAGGAAGCATGAT
hide sequence
RefSeq Acc Id:
NP_071598 ⟸ NM_022262
- UniProtKB:
Q9JHB5 (UniProtKB/Swiss-Prot), A6KJ28 (UniProtKB/TrEMBL)
- Sequence:
MNGKEGPGGFRKRKHDNFPHNQRREGKDASSSSPVMLAFKSFQQELDTRHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEEILTESESKLDGVRQKMLQVAQELSGEDMHQFHRAVTTGLQEYV
hide sequence
Ensembl Acc Id:
ENSRNOP00000063911 ⟸ ENSRNOT00000071827
RGD ID: 13701247 Promoter ID: EPDNEW_R11770 Type: initiation region Name: Tsnax_1 Description: translin-associated factor X SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 57,771,471 - 57,771,531 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Tsnax
translin-associated factor X
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Tsnax
translin-associated factor X
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
contains a leucine zipper motif
634412
