Symbol:
Clk3
Name:
CDC-like kinase 3
RGD ID:
621259
Description:
Enables protein kinase activity. Predicted to be involved in protein phosphorylation and regulation of RNA splicing. Predicted to act upstream of or within peptidyl-tyrosine phosphorylation and protein autophosphorylation. Predicted to be located in intermediate filament cytoskeleton and nucleoplasm. Predicted to be active in nucleus. Orthologous to human CLK3 (CDC like kinase 3); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
dual specificity protein kinase CLK3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CLK3 (CDC like kinase 3) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Clk3 (CDC-like kinase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Clk3 (CDC like kinase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CLK3 (CDC like kinase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CLK3 (CDC like kinase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Clk3 (CDC like kinase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CLK3 (CDC like kinase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CLK3 (CDC like kinase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Clk3 (CDC like kinase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CLK3 (CDC like kinase 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Clk3 (CDC-like kinase 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Doa
Alliance
DIOPT (OrthoFinder|OrthoInspector|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
KNS1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
madd-3
Alliance
DIOPT (OrthoFinder|OrthoInspector|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
clk3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 67,048,121 - 67,063,192 (-) NCBI GRCr8 mRatBN7.2 8 58,152,155 - 58,167,196 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 58,152,155 - 58,168,181 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 63,685,282 - 63,698,791 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 61,962,856 - 61,976,365 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 59,827,402 - 59,840,911 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 62,528,135 - 62,543,550 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 62,528,225 - 62,542,622 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 62,305,094 - 62,320,487 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 61,519,196 - 61,532,816 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 61,538,249 - 61,551,870 (-) NCBI Celera 8 57,617,880 - 57,631,407 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Clk3 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:733625 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of CLK3 mRNA CTD PMID:22079256 Clk3 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1553651 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CLK3 mRNA CTD PMID:36331819 Clk3 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1553651 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of CLK3 mRNA] CTD PMID:22206623 Clk3 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1553651 6480464 1,2-Dimethylhydrazine results in increased expression of CLK3 mRNA CTD PMID:22206623 Clk3 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1553651 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CLK3 mRNA CTD PMID:17942748 Clk3 Rat 17beta-estradiol decreases expression ISO RGD:1553651 6480464 Estradiol results in decreased expression of CLK3 mRNA CTD PMID:39298647 Clk3 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of CLK3 mRNA CTD PMID:35192832 Clk3 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:733625 6480464 2,2',4,4'-tetrabromodiphenyl ether analog results in increased expression of CLK3 mRNA CTD PMID:19095052 Clk3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1553651 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CLK3 mRNA CTD PMID:17942748 Clk3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1553651 6480464 Tetrachlorodibenzodioxin affects the expression of CLK3 mRNA CTD PMID:21570461 Clk3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CLK3 mRNA CTD PMID:16960034|PMID:21215274|PMID:33387578 Clk3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1553651 6480464 Tetrachlorodibenzodioxin results in increased expression of CLK3 mRNA CTD PMID:16960034 Clk3 Rat 2-hydroxypropanoic acid decreases expression ISO RGD:733625 6480464 Lactic Acid results in decreased expression of CLK3 mRNA CTD PMID:30851411 Clk3 Rat 3-methylcholanthrene multiple interactions ISO RGD:733625 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to CLK3 promoter] CTD PMID:20348232 Clk3 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1553651 6480464 4,4'-diaminodiphenylmethane results in decreased expression of CLK3 mRNA CTD PMID:18648102 Clk3 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1553651 6480464 bisphenol S results in decreased expression of CLK3 mRNA CTD PMID:39298647 Clk3 Rat 4-hydroxynon-2-enal decreases expression ISO RGD:733625 6480464 4-hydroxy-2-nonenal results in decreased expression of CLK3 mRNA CTD PMID:12419474 Clk3 Rat 5-iodotubercidin decreases activity ISO RGD:733625 6480464 5-iodotubercidin results in decreased activity of CLK3 protein CTD PMID:26953159 Clk3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CLK3 mRNA CTD PMID:30047161 Clk3 Rat acetylsalicylic acid decreases expression ISO RGD:733625 6480464 Aspirin results in decreased expression of CLK3 mRNA CTD PMID:15928584 Clk3 Rat all-trans-retinoic acid increases expression ISO RGD:733625 6480464 Tretinoin results in increased expression of CLK3 mRNA CTD PMID:33167477 Clk3 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of CLK3 mRNA CTD PMID:30047161 Clk3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CLK3 mRNA CTD PMID:16483693 Clk3 Rat aristolochic acid A increases expression ISO RGD:733625 6480464 aristolochic acid I results in increased expression of CLK3 mRNA CTD PMID:33212167 Clk3 Rat arsenous acid increases expression ISO RGD:733625 6480464 Arsenic Trioxide results in increased expression of CLK3 mRNA CTD PMID:20458559 Clk3 Rat atrazine increases expression ISO RGD:733625 6480464 Atrazine results in increased expression of CLK3 mRNA CTD PMID:22378314 Clk3 Rat avobenzone increases expression ISO RGD:733625 6480464 avobenzone results in increased expression of CLK3 mRNA CTD PMID:31016361 Clk3 Rat benzo[a]pyrene increases expression ISO RGD:1553651 6480464 Benzo(a)pyrene results in increased expression of CLK3 mRNA CTD PMID:21569818 Clk3 Rat benzo[a]pyrene affects methylation ISO RGD:733625 6480464 Benzo(a)pyrene affects the methylation of CLK3 promoter CTD PMID:27901495 Clk3 Rat benzo[e]pyrene affects methylation ISO RGD:733625 6480464 benzo(e)pyrene affects the methylation of CLK3 intron CTD PMID:30157460 Clk3 Rat beta-lapachone increases expression ISO RGD:733625 6480464 beta-lapachone results in increased expression of CLK3 mRNA CTD PMID:38218311 Clk3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CLK3 mRNA CTD PMID:25181051|PMID:32145629|PMID:35192832 Clk3 Rat bisphenol A increases methylation ISO RGD:733625 6480464 bisphenol A results in increased methylation of CLK3 gene CTD PMID:31601247 Clk3 Rat bisphenol A decreases expression ISO RGD:733625 6480464 bisphenol A results in decreased expression of CLK3 protein CTD PMID:33376534 Clk3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CLK3 mRNA CTD PMID:30816183|PMID:32528016 Clk3 Rat bisphenol F decreases expression ISO RGD:1553651 6480464 bisphenol F results in decreased expression of CLK3 mRNA CTD PMID:38685157 Clk3 Rat caffeine increases phosphorylation ISO RGD:733625 6480464 Caffeine results in increased phosphorylation of CLK3 protein CTD PMID:35688186 Clk3 Rat chlorpyrifos increases expression ISO RGD:1553651 6480464 Chlorpyrifos results in increased expression of CLK3 mRNA CTD PMID:37019170 Clk3 Rat chromium(6+) increases expression ISO RGD:733625 6480464 chromium hexavalent ion results in increased expression of CLK3 mRNA CTD PMID:30690063 Clk3 Rat chromium(6+) increases expression EXP 6480464 chromium hexavalent ion results in increased expression of CLK3 mRNA CTD PMID:30690063 Clk3 Rat cobalt dichloride increases expression ISO RGD:733625 6480464 cobaltous chloride results in increased expression of CLK3 mRNA CTD PMID:19320972 Clk3 Rat copper(II) sulfate increases expression ISO RGD:733625 6480464 Copper Sulfate results in increased expression of CLK3 mRNA CTD PMID:19549813 Clk3 Rat coumarin decreases phosphorylation ISO RGD:733625 6480464 coumarin results in decreased phosphorylation of CLK3 protein CTD PMID:35688186 Clk3 Rat cyclosporin A increases expression ISO RGD:733625 6480464 Cyclosporine results in increased expression of CLK3 mRNA CTD PMID:25562108 Clk3 Rat diarsenic trioxide increases expression ISO RGD:733625 6480464 Arsenic Trioxide results in increased expression of CLK3 mRNA CTD PMID:20458559 Clk3 Rat Dibutyl phosphate affects expression ISO RGD:733625 6480464 di-n-butylphosphoric acid affects the expression of CLK3 mRNA CTD PMID:37042841 Clk3 Rat diquat increases expression ISO RGD:1553651 6480464 Diquat results in increased expression of CLK3 protein CTD PMID:36851058 Clk3 Rat disodium selenite affects expression ISO RGD:733625 6480464 Sodium Selenite affects the expression of CLK3 mRNA CTD PMID:16705456 Clk3 Rat doxorubicin decreases expression ISO RGD:733625 6480464 Doxorubicin results in decreased expression of CLK3 mRNA CTD PMID:29803840 Clk3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of CLK3 mRNA CTD PMID:29391264 Clk3 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of CLK3 mRNA CTD PMID:15353170 Clk3 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CLK3 mRNA CTD PMID:24793618 Clk3 Rat folic acid multiple interactions ISO RGD:1553651 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of CLK3 mRNA] CTD PMID:22206623 Clk3 Rat FR900359 affects phosphorylation ISO RGD:733625 6480464 FR900359 affects the phosphorylation of CLK3 protein CTD PMID:37730182 Clk3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CLK3 mRNA CTD PMID:33387578 Clk3 Rat GSK-J4 increases expression ISO RGD:733625 6480464 GSK-J4 results in increased expression of CLK3 mRNA CTD PMID:29301935 Clk3 Rat iron dichloride increases expression ISO RGD:733625 6480464 ferrous chloride results in increased expression of CLK3 mRNA CTD PMID:35984750 Clk3 Rat leflunomide increases expression ISO RGD:733625 6480464 leflunomide results in increased expression of CLK3 mRNA CTD PMID:28988120 Clk3 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of CLK3 mRNA CTD PMID:24136188 Clk3 Rat methapyrilene affects methylation ISO RGD:733625 6480464 Methapyrilene affects the methylation of CLK3 intron CTD PMID:30157460 Clk3 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CLK3 mRNA CTD PMID:30047161 Clk3 Rat paracetamol affects expression ISO RGD:1553651 6480464 Acetaminophen affects the expression of CLK3 mRNA CTD PMID:17562736 Clk3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CLK3 mRNA CTD PMID:33387578 Clk3 Rat paraoxon increases expression ISO RGD:1553651 6480464 Paraoxon results in increased expression of CLK3 mRNA CTD PMID:22093924 Clk3 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of CLK3 mRNA CTD PMID:16328009 Clk3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1553651 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CLK3 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Clk3 Rat phenobarbital affects expression ISO RGD:733625 6480464 Phenobarbital affects the expression of CLK3 mRNA CTD PMID:19159669 Clk3 Rat potassium chromate multiple interactions ISO RGD:733625 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of CLK3 mRNA CTD PMID:22079256 Clk3 Rat potassium chromate increases expression ISO RGD:733625 6480464 potassium chromate(VI) results in increased expression of CLK3 mRNA CTD PMID:22079256 Clk3 Rat quercetin decreases phosphorylation ISO RGD:733625 6480464 Quercetin results in decreased phosphorylation of CLK3 protein CTD PMID:35688186 Clk3 Rat rac-lactic acid decreases expression ISO RGD:733625 6480464 Lactic Acid results in decreased expression of CLK3 mRNA CTD PMID:30851411 Clk3 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of CLK3 mRNA CTD PMID:12325037 Clk3 Rat sodium dodecyl sulfate decreases expression ISO RGD:733625 6480464 Sodium Dodecyl Sulfate results in decreased expression of CLK3 mRNA CTD PMID:31734321 Clk3 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of CLK3 mRNA CTD PMID:30047161 Clk3 Rat sunitinib increases expression ISO RGD:733625 6480464 Sunitinib results in increased expression of CLK3 mRNA CTD PMID:31533062 Clk3 Rat tacrolimus hydrate increases expression ISO RGD:1553651 6480464 Tacrolimus results in increased expression of CLK3 mRNA CTD PMID:25270620 Clk3 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CLK3 mRNA CTD PMID:34492290 Clk3 Rat thiram increases expression ISO RGD:733625 6480464 Thiram results in increased expression of CLK3 mRNA CTD PMID:38568856 Clk3 Rat titanium dioxide decreases methylation ISO RGD:1553651 6480464 titanium dioxide results in decreased methylation of CLK3 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Clk3 Rat titanium dioxide increases methylation ISO RGD:1553651 6480464 titanium dioxide results in increased methylation of CLK3 gene CTD PMID:35295148 Clk3 Rat triphenyl phosphate affects expression ISO RGD:733625 6480464 triphenyl phosphate affects the expression of CLK3 mRNA CTD PMID:37042841 Clk3 Rat valproic acid increases expression ISO RGD:733625 6480464 Valproic Acid results in increased expression of CLK3 mRNA CTD PMID:28001369 Clk3 Rat zinc atom multiple interactions ISO RGD:733625 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CLK3 mRNA CTD PMID:18593933 Clk3 Rat zinc(0) multiple interactions ISO RGD:733625 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CLK3 mRNA CTD PMID:18593933
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Clk3 Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Clk3 Rat ATP binding enables IEA InterPro:IPR000719|InterPro:IPR017441 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Clk3 Rat ATP binding enables IEA UniRule:UR001503341 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Clk3 Rat identical protein binding enables IEA UniProtKB:P49761|ensembl:ENSP00000378505 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clk3 Rat identical protein binding enables ISO RGD:733625 1624291 UniProtKB:P49761 PMID:25416956, PMID:32296183 RGD PMID:25416956|PMID:32296183 Clk3 Rat kinase activity IDA 727235 RGD Clk3 Rat kinase activity enables IEA UniProtKB-KW:KW-0418 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Clk3 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Clk3 Rat nucleotide binding enables IEA UniRule:UR001503341 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Clk3 Rat protein binding enables ISO RGD:733625 1624291 UniProtKB:O00560|UniProtKB:O14492-2|UniProtKB:O14978|UniProtKB:O43463|UniProtKB:O75494|UniProtKB:O76064|UniProtKB:P08238|UniProtKB:P09017|UniProtKB:P09629|UniProtKB:P0DJD3|UniProtKB:P10523|UniProtKB:P17509|UniProtKB:P29728|UniProtKB:P29728-2|UniProtKB:P38159|UniProtKB:P49760|UniProtKB:P62258|UniProtKB:P62995|UniProtKB:P78362|UniProtKB:P84103|UniProtKB:Q0VD86|UniProtKB:Q15287|UniProtKB:Q15415|UniProtKB:Q16560-2|UniProtKB:Q5M9Q1|UniProtKB:Q8IWX8|UniProtKB:Q8N2M8|UniProtKB:Q8TAD8|UniProtKB:Q8TBB1|UniProtKB:Q8WTR7|UniProtKB:Q96D03|UniProtKB:Q9BRL6-2|UniProtKB:Q9BSI4|UniProtKB:Q9BUV0|UniProtKB:Q9UBU9|UniProtKB:Q9ULD5|UniProtKB:Q9Y2P0 PMID:16189514, PMID:21044950, PMID:21516116, PMID:22939624, PMID:23455924, PMID:23602568, PMID:25416956, PMID:31515488, PMID:32296183, PMID:32707033, PMID:33961781, PMID:36931259 RGD PMID:16189514|PMID:21044950|PMID:21516116|PMID:22939624|PMID:23455924|PMID:23602568|PMID:25416956|PMID:31515488|PMID:32296183|PMID:32707033|PMID:33961781|PMID:36931259 Clk3 Rat protein kinase activity IDA 727235 RGD Clk3 Rat protein kinase activity enables IEA InterPro:IPR000719|InterPro:IPR008271 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Clk3 Rat protein serine kinase activity enables IEA RHEA:17989 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Clk3 Rat protein serine/threonine kinase activity enables ISS UniProtKB:O35492 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clk3 Rat protein serine/threonine kinase activity enables IBA FB:FBgn0265998|MGI:107403|MGI:1098551|MGI:1098669|MGI:1098670|PANTHER:PTN000624720|PomBase:SPAC1D4.11c|SGD:S000003942|UniProtKB:P49759|UniProtKB:P49760 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Clk3 Rat protein serine/threonine kinase activity enables ISO RGD:1553651 1624291 PMID:9307018 RGD PMID:9307018 Clk3 Rat protein serine/threonine kinase activity enables IEA UniProtKB-KW:KW-0723 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Clk3 Rat protein serine/threonine/tyrosine kinase activity enables IEA EC:2.7.12.1 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Clk3 Rat protein tyrosine kinase activity enables IEA UniProtKB-KW:KW-0829 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Clk3 Rat protein tyrosine kinase activity enables ISO RGD:1553651 1624291 PMID:9307018 RGD PMID:9307018 Clk3 Rat protein tyrosine kinase activity enables IBA MGI:107403|MGI:1098551|MGI:1098669|MGI:1098670|PANTHER:PTN000624723 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Clk3 Rat protein tyrosine kinase activity enables IEA RHEA:10596 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Clk3 Rat transferase activity enables IEA UniProtKB-KW:KW-0808 1600115 GO_REF:0000043 UniProt GO_REF:0000043
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 5-iodotubercidin (ISO) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsenous acid (ISO) atrazine (ISO) avobenzone (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) caffeine (ISO) chlorpyrifos (ISO) chromium(6+) (EXP,ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) diquat (ISO) disodium selenite (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) GSK-J4 (ISO) iron dichloride (ISO) leflunomide (EXP,ISO) methapyrilene (ISO) methimazole (EXP) paracetamol (EXP,ISO) paraoxon (ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) potassium chromate (ISO) quercetin (ISO) rac-lactic acid (ISO) sodium dichromate (EXP) sodium dodecyl sulfate (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tacrolimus hydrate (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Clk3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 67,048,121 - 67,063,192 (-) NCBI GRCr8 mRatBN7.2 8 58,152,155 - 58,167,196 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 58,152,155 - 58,168,181 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 63,685,282 - 63,698,791 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 61,962,856 - 61,976,365 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 59,827,402 - 59,840,911 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 62,528,135 - 62,543,550 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 62,528,225 - 62,542,622 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 62,305,094 - 62,320,487 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 61,519,196 - 61,532,816 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 61,538,249 - 61,551,870 (-) NCBI Celera 8 57,617,880 - 57,631,407 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
CLK3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 74,608,372 - 74,630,201 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 74,598,500 - 74,645,414 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 74,900,713 - 74,922,542 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 72,687,766 - 72,709,511 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 72,687,765 - 72,709,511 NCBI Celera 15 51,850,648 - 51,872,477 (+) NCBI Celera Cytogenetic Map 15 q24.1 NCBI HuRef 15 51,698,874 - 51,720,703 (+) NCBI HuRef CHM1_1 15 75,019,166 - 75,040,995 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 72,478,273 - 72,500,102 (+) NCBI T2T-CHM13v2.0
Clk3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 57,657,904 - 57,672,397 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 57,657,907 - 57,673,143 (-) Ensembl GRCm39 Ensembl GRCm38 9 57,750,621 - 57,766,235 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 57,750,624 - 57,765,860 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 57,598,518 - 57,613,667 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 57,548,848 - 57,563,997 (-) NCBI MGSCv36 mm8 Celera 9 54,979,934 - 54,995,075 (-) NCBI Celera Cytogenetic Map 9 B NCBI cM Map 9 31.47 NCBI
Clk3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955450 3,250,444 - 3,262,920 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955450 3,250,169 - 3,262,977 (-) NCBI ChiLan1.0 ChiLan1.0
CLK3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 63,840,095 - 63,861,949 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 68,003,680 - 68,025,617 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 53,550,793 - 53,576,744 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 73,181,664 - 73,196,466 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 73,181,664 - 73,196,148 (+) Ensembl panpan1.1 panPan2
CLK3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 37,706,895 - 37,719,693 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 37,706,645 - 37,719,684 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 37,640,472 - 37,653,252 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 37,912,348 - 37,925,129 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 37,915,589 - 37,925,202 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 37,864,932 - 37,877,712 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 37,890,620 - 37,903,396 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 38,145,976 - 38,158,756 (+) NCBI UU_Cfam_GSD_1.0
Clk3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 115,752,697 - 115,767,123 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 33,600,544 - 33,618,378 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 33,600,909 - 33,615,186 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CLK3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 58,895,419 - 58,909,551 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 58,895,407 - 58,909,616 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 63,583,925 - 63,598,457 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CLK3
Clk3
.
Predicted Target Of
Count of predictions: 65 Count of miRNA genes: 52 Interacting mature miRNAs: 59 Transcripts: ENSRNOT00000068108 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat
BE116970
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 58,152,390 - 58,152,626 (+) MAPPER mRatBN7.2 Rnor_6.0 8 62,528,371 - 62,528,606 NCBI Rnor6.0 Rnor_5.0 8 62,305,330 - 62,305,565 UniSTS Rnor5.0 RGSC_v3.4 8 61,519,342 - 61,519,577 UniSTS RGSC3.4 Celera 8 57,618,026 - 57,618,261 UniSTS RH 3.4 Map 8 670.1 UniSTS Cytogenetic Map 8 q24 UniSTS
RH136098
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 58,152,848 - 58,153,016 (+) MAPPER mRatBN7.2 Rnor_6.0 8 62,528,829 - 62,528,996 NCBI Rnor6.0 Rnor_5.0 8 62,305,788 - 62,305,955 UniSTS Rnor5.0 RGSC_v3.4 8 61,519,800 - 61,519,967 UniSTS RGSC3.4 Celera 8 57,618,484 - 57,618,651 UniSTS Cytogenetic Map 8 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068108 ⟹ ENSRNOP00000061691
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 58,152,155 - 58,166,886 (-) Ensembl Rnor_6.0 Ensembl 8 62,528,225 - 62,541,959 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000080071 ⟹ ENSRNOP00000072998
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 58,152,182 - 58,168,181 (-) Ensembl Rnor_6.0 Ensembl 8 62,528,259 - 62,542,622 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110279 ⟹ ENSRNOP00000097825
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 58,152,246 - 58,166,141 (-) Ensembl
RefSeq Acc Id:
NM_134340 ⟹ NP_599167
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 67,048,123 - 67,061,649 (-) NCBI mRatBN7.2 8 58,152,245 - 58,165,775 (-) NCBI Rnor_6.0 8 62,528,225 - 62,541,959 (-) NCBI Rnor_5.0 8 62,305,094 - 62,320,487 (-) NCBI RGSC_v3.4 8 61,519,196 - 61,532,816 (-) RGD Celera 8 57,617,880 - 57,631,407 (-) RGD
Sequence:
GGCACGAGCCAGGCTGCTCCTCGGTCCGGTCGGGAGCCTCTATGCTTTAGTTCCGGATGCATCACTGTAAGCGATACCGTTCCCCAGAGCCAGACCCATACCTGAGCTACCGCTGGAAGAGGAGGCGG
hide sequence
RefSeq Acc Id:
XM_006243146 ⟹ XP_006243208
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 67,048,121 - 67,063,192 (-) NCBI mRatBN7.2 8 58,152,155 - 58,167,196 (-) NCBI Rnor_6.0 8 62,528,135 - 62,543,550 (-) NCBI Rnor_5.0 8 62,305,094 - 62,320,487 (-) NCBI
Sequence:
GGCAATTAGGCGCCGCACCCGCCCGCTTGGCTGCGCAACGCGCGGGGGCGGGGACGCTGTCAAAGCGAGGCCCTACCAAAGGACCGCGACTTGTATTCTCTTCTGAAAAAATAAGACCTCATGATCCT
hide sequence
RefSeq Acc Id:
XM_039080747 ⟹ XP_038936675
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 67,048,121 - 67,062,013 (-) NCBI mRatBN7.2 8 58,152,155 - 58,165,031 (-) NCBI
RefSeq Acc Id:
XM_063264824 ⟹ XP_063120894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 67,048,121 - 67,062,054 (-) NCBI
RefSeq Acc Id:
XM_063264825 ⟹ XP_063120895
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 67,048,121 - 67,062,225 (-) NCBI
RefSeq Acc Id:
XM_063264826 ⟹ XP_063120896
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 67,048,121 - 67,061,586 (-) NCBI
RefSeq Acc Id:
XM_063264827 ⟹ XP_063120897
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 67,048,121 - 67,062,236 (-) NCBI
RefSeq Acc Id:
NP_599167 ⟸ NM_134340
- UniProtKB:
Q63117 (UniProtKB/Swiss-Prot), Q6IRK2 (UniProtKB/Swiss-Prot), A6J4X9 (UniProtKB/TrEMBL), A0A8I6GM85 (UniProtKB/TrEMBL)
- Sequence:
MHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRIPYQRRYREHRDSDTYRCEERSPSFGEDCYGSSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQS
hide sequence
RefSeq Acc Id:
XP_006243208 ⟸ XM_006243146
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2UQV5 (UniProtKB/TrEMBL)
- Sequence:
MPVLSSRRKRLASIAGPRRGSGPSLAVRWVPPLGLELASDRGRGRAQMRPRGPTCTTTRRGAGRRPRMLPGPPGRDLQRCGPDPGGASQSPRVCELAARAARPLGRVEPGPPTAASREGAVLPRAEAR
hide sequence
Ensembl Acc Id:
ENSRNOP00000072998 ⟸ ENSRNOT00000080071
Ensembl Acc Id:
ENSRNOP00000061691 ⟸ ENSRNOT00000068108
RefSeq Acc Id:
XP_038936675 ⟸ XM_039080747
- Peptide Label:
isoform X2
- UniProtKB:
Q63117 (UniProtKB/Swiss-Prot), Q6IRK2 (UniProtKB/Swiss-Prot), A6J4X9 (UniProtKB/TrEMBL), A0A8I6GM85 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000097825 ⟸ ENSRNOT00000110279
RefSeq Acc Id:
XP_063120897 ⟸ XM_063264827
- Peptide Label:
isoform X2
- UniProtKB:
Q6IRK2 (UniProtKB/Swiss-Prot), Q63117 (UniProtKB/Swiss-Prot), A0A8I6GM85 (UniProtKB/TrEMBL), A6J4X9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120895 ⟸ XM_063264825
- Peptide Label:
isoform X2
- UniProtKB:
Q6IRK2 (UniProtKB/Swiss-Prot), Q63117 (UniProtKB/Swiss-Prot), A0A8I6GM85 (UniProtKB/TrEMBL), A6J4X9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120894 ⟸ XM_063264824
- Peptide Label:
isoform X2
- UniProtKB:
Q6IRK2 (UniProtKB/Swiss-Prot), Q63117 (UniProtKB/Swiss-Prot), A0A8I6GM85 (UniProtKB/TrEMBL), A6J4X9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120896 ⟸ XM_063264826
- Peptide Label:
isoform X2
- UniProtKB:
Q6IRK2 (UniProtKB/Swiss-Prot), Q63117 (UniProtKB/Swiss-Prot), A0A8I6GM85 (UniProtKB/TrEMBL), A6J4X9 (UniProtKB/TrEMBL)
RGD ID: 13696020 Promoter ID: EPDNEW_R6545 Type: single initiation site Name: Clk3_2 Description: CDC-like kinase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R6546 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 62,541,919 - 62,541,979 EPDNEW
RGD ID: 13696027 Promoter ID: EPDNEW_R6546 Type: initiation region Name: Clk3_1 Description: CDC-like kinase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R6545 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 62,542,583 - 62,542,643 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Clk3
CDC-like kinase 3
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Clk3
CDC-like kinase 3
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
mRNA is expressed predominantly in testis
727235
