Advanced Search (OLGA)

Gene: Ppp4r1 (protein phosphatase 4, regulatory subunit 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ppp4r1

Name:

protein phosphatase 4, regulatory subunit 1

RGD ID:

619798

Description:

Predicted to enable protein phosphatase regulator activity. Predicted to be active in cytoplasm. Orthologous to human PPP4R1 (protein phosphatase 4 regulatory subunit 1); INTERACTS WITH 2,6-dinitrotoluene; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Pp4r1; serine/threonine-protein phosphatase 4 regulatory subunit 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	112,836,950 - 112,897,490 (+)	NCBI		GRCr8
mRatBN7.2	9	105,391,271 - 105,450,626 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	105,391,412 - 105,450,633 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	113,798,599 - 113,859,120 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	118,905,997 - 118,969,026 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	117,264,559 - 117,324,969 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	113,515,312 - 113,573,308 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	113,534,326 - 113,573,307 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	113,066,545 - 113,105,528 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	104,572,704 - 104,611,601 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	104,782,185 - 104,821,080 (+)	NCBI
Celera	9	102,770,161 - 102,827,110 (+)	NCBI		Celera
Cytogenetic Map	9	q37	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp4r1	Rat	chromosome 18p deletion syndrome		ISO	PPP4R1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Del(18p) syndrome	ClinVar	PMID:31690835
Ppp4r1	Rat	dystonia		ISO	PPP4R1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dystonic disorder	ClinVar	PMID:25817843 and PMID:28492532
Ppp4r1	Rat	intellectual disability		ISO	PPP4R1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp4r1	Rat	1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane	increases expression	ISO	Ppp4r1 (Mus musculus)	6480464	2 more ...	CTD	PMID:25575267
Ppp4r1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Ppp4r1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of PPP4R1 mRNA	CTD	PMID:22206623
Ppp4r1	Rat	17alpha-ethynylestradiol	affects expression	ISO	Ppp4r1 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of PPP4R1 mRNA	CTD	PMID:17555576
Ppp4r1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Ppp4r1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PPP4R1 mRNA	CTD	PMID:17942748
Ppp4r1	Rat	17alpha-ethynylestradiol	increases expression	ISO	Ppp4r1 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of PPP4R1 mRNA	CTD	PMID:17942748
Ppp4r1	Rat	17beta-estradiol	increases expression	ISO	Ppp4r1 (Mus musculus)	6480464	Estradiol results in increased expression of PPP4R1 mRNA	CTD	PMID:25575267
Ppp4r1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Ppp4r1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PPP4R1 mRNA	CTD	PMID:17942748
Ppp4r1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ppp4r1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of PPP4R1 mRNA	CTD	PMID:21570461
Ppp4r1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Ppp4r1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of PPP4R1 mRNA	CTD	PMID:19465110
Ppp4r1	Rat	2,6-dimethoxyphenol	multiple interactions	ISO	PPP4R1 (Homo sapiens)	6480464	[Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of PPP4R1 protein	CTD	PMID:38598786
Ppp4r1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of PPP4R1 mRNA	CTD	PMID:21346803
Ppp4r1	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of PPP4R1 protein	CTD	PMID:34915118
Ppp4r1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of PPP4R1 mRNA	CTD	PMID:30047161
Ppp4r1	Rat	acrolein	multiple interactions	ISO	PPP4R1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PPP4R1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PPP4R1 mRNA	CTD	PMID:32699268
Ppp4r1	Rat	all-trans-retinoic acid	decreases expression	ISO	PPP4R1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of PPP4R1 mRNA	CTD	PMID:33167477
Ppp4r1	Rat	alpha-pinene	multiple interactions	ISO	PPP4R1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PPP4R1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PPP4R1 mRNA	CTD	PMID:32699268
Ppp4r1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of PPP4R1 mRNA	CTD	PMID:30047161
Ppp4r1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of PPP4R1 mRNA	CTD	PMID:16483693
Ppp4r1	Rat	arsenite(3-)	multiple interactions	ISO	PPP4R1 (Homo sapiens)	6480464	arsenite inhibits the reaction [G3BP1 protein binds to PPP4R1 mRNA]	CTD	PMID:32406909
Ppp4r1	Rat	atrazine	decreases expression	ISO	PPP4R1 (Homo sapiens)	6480464	Atrazine results in decreased expression of PPP4R1 mRNA	CTD	PMID:22378314
Ppp4r1	Rat	auramine O	increases expression	ISO	PPP4R1 (Homo sapiens)	6480464	Benzophenoneidum results in increased expression of PPP4R1 protein	CTD	PMID:28722353
Ppp4r1	Rat	benzo[a]pyrene	increases expression	ISO	Ppp4r1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of PPP4R1 mRNA	CTD	PMID:22228805
Ppp4r1	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	PPP4R1 (Homo sapiens)	6480464	7 more ...	CTD	PMID:19150397
Ppp4r1	Rat	beta-naphthoflavone	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of PPP4R1 mRNA	CTD	PMID:18164116
Ppp4r1	Rat	bisphenol A	increases expression	ISO	Ppp4r1 (Mus musculus)	6480464	bisphenol A results in increased expression of PPP4R1 mRNA	CTD	PMID:25575267
Ppp4r1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of PPP4R1 gene	CTD	PMID:28505145
Ppp4r1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of PPP4R1 mRNA	CTD	PMID:25181051
Ppp4r1	Rat	bisphenol F	increases expression	ISO	Ppp4r1 (Mus musculus)	6480464	bisphenol F results in increased expression of PPP4R1 mRNA	CTD	PMID:38685157
Ppp4r1	Rat	cadmium dichloride	decreases expression	ISO	PPP4R1 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of PPP4R1 mRNA	CTD	PMID:38568856
Ppp4r1	Rat	caffeine	decreases phosphorylation	ISO	PPP4R1 (Homo sapiens)	6480464	Caffeine results in decreased phosphorylation of PPP4R1 protein	CTD	PMID:35688186
Ppp4r1	Rat	cobalt dichloride	decreases expression	ISO	PPP4R1 (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of PPP4R1 mRNA	CTD	PMID:19320972
Ppp4r1	Rat	copper(II) sulfate	decreases expression	ISO	PPP4R1 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of PPP4R1 mRNA	CTD	PMID:19549813
Ppp4r1	Rat	crocidolite asbestos	decreases expression	ISO	Ppp4r1 (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of PPP4R1 mRNA	CTD	PMID:29279043
Ppp4r1	Rat	decabromodiphenyl ether	decreases expression	ISO	PPP4R1 (Homo sapiens)	6480464	decabromobiphenyl ether results in decreased expression of PPP4R1 protein	CTD	PMID:31675489
Ppp4r1	Rat	Dibutyl phosphate	affects expression	ISO	PPP4R1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of PPP4R1 mRNA	CTD	PMID:37042841
Ppp4r1	Rat	diethylstilbestrol	increases expression	ISO	Ppp4r1 (Mus musculus)	6480464	Diethylstilbestrol results in increased expression of PPP4R1 mRNA	CTD	PMID:25575267
Ppp4r1	Rat	estriol	increases expression	ISO	Ppp4r1 (Mus musculus)	6480464	Estriol results in increased expression of PPP4R1 mRNA	CTD	PMID:25575267
Ppp4r1	Rat	ethanol	affects splicing	ISO	Ppp4r1 (Mus musculus)	6480464	Ethanol affects the splicing of PPP4R1 mRNA	CTD	PMID:30319688
Ppp4r1	Rat	ethanol	affects expression	ISO	Ppp4r1 (Mus musculus)	6480464	Ethanol affects the expression of PPP4R1 mRNA	CTD	PMID:30319688
Ppp4r1	Rat	flavonoids	decreases expression	EXP		6480464	Flavonoids results in decreased expression of PPP4R1 mRNA	CTD	PMID:18035473
Ppp4r1	Rat	folic acid	decreases expression	ISO	PPP4R1 (Homo sapiens)	6480464	Folic Acid results in decreased expression of PPP4R1 mRNA	CTD	PMID:21867686
Ppp4r1	Rat	furfural	multiple interactions	ISO	PPP4R1 (Homo sapiens)	6480464	[Sodium Chloride co-treated with Furaldehyde] results in decreased expression of PPP4R1 protein	CTD	PMID:38598786
Ppp4r1	Rat	ivermectin	decreases expression	ISO	PPP4R1 (Homo sapiens)	6480464	Ivermectin results in decreased expression of PPP4R1 protein	CTD	PMID:32959892
Ppp4r1	Rat	kojic acid	increases expression	ISO	PPP4R1 (Homo sapiens)	6480464	kojic acid results in increased expression of PPP4R1 mRNA	CTD	PMID:16595896
Ppp4r1	Rat	lead(0)	affects expression	ISO	PPP4R1 (Homo sapiens)	6480464	Lead affects the expression of PPP4R1 mRNA	CTD	PMID:28903495
Ppp4r1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of PPP4R1 mRNA	CTD	PMID:30047161
Ppp4r1	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of PPP4R1 mRNA	CTD	PMID:18164116
Ppp4r1	Rat	ozone	multiple interactions	ISO	PPP4R1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PPP4R1 mRNA more ...	CTD	PMID:32699268
Ppp4r1	Rat	paracetamol	affects expression	ISO	Ppp4r1 (Mus musculus)	6480464	Acetaminophen affects the expression of PPP4R1 mRNA	CTD	PMID:17562736
Ppp4r1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of PPP4R1 mRNA	CTD	PMID:33387578
Ppp4r1	Rat	paracetamol	decreases expression	ISO	PPP4R1 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of PPP4R1 mRNA	CTD	PMID:21420995
Ppp4r1	Rat	propiconazole	increases expression	EXP		6480464	propiconazole results in increased expression of PPP4R1 mRNA	CTD	PMID:30047161
Ppp4r1	Rat	sodium arsenite	decreases expression	ISO	PPP4R1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of PPP4R1 mRNA	CTD	PMID:38568856
Ppp4r1	Rat	sodium chloride	multiple interactions	ISO	PPP4R1 (Homo sapiens)	6480464	[Sodium Chloride co-treated with Furaldehyde] results in decreased expression of PPP4R1 protein more ...	CTD	PMID:38598786
Ppp4r1	Rat	Soman	increases expression	EXP		6480464	Soman results in increased expression of PPP4R1 mRNA	CTD	PMID:19281266
Ppp4r1	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of PPP4R1 mRNA	CTD	PMID:30047161
Ppp4r1	Rat	tamoxifen	affects expression	ISO	Ppp4r1 (Mus musculus)	6480464	Tamoxifen affects the expression of PPP4R1 mRNA	CTD	PMID:17555576
Ppp4r1	Rat	tetrachloromethane	increases expression	ISO	Ppp4r1 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of PPP4R1 mRNA	CTD	PMID:27339419 and PMID:31919559
Ppp4r1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of PPP4R1 mRNA	CTD	PMID:34492290
Ppp4r1	Rat	titanium dioxide	decreases methylation	ISO	Ppp4r1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of PPP4R1 gene	CTD	PMID:35295148
Ppp4r1	Rat	triphenyl phosphate	affects expression	ISO	PPP4R1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of PPP4R1 mRNA	CTD	PMID:37042841
Ppp4r1	Rat	valproic acid	affects expression	ISO	Ppp4r1 (Mus musculus)	6480464	Valproic Acid affects the expression of PPP4R1 mRNA	CTD	PMID:17292431
Ppp4r1	Rat	valproic acid	affects expression	ISO	PPP4R1 (Homo sapiens)	6480464	Valproic Acid affects the expression of PPP4R1 mRNA	CTD	PMID:25979313
Ppp4r1	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of PPP4R1 mRNA	CTD	PMID:18042343

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp4r1	Rat	cytoplasm	is_active_in	IBA	FB:FBgn0260439 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp4r1	Rat	protein binding	enables	ISO	PPP4R1 (Homo sapiens)	1624291	UniProtKB:P60510 more ...	RGD	PMID:16085932 more ...
Ppp4r1	Rat	protein phosphatase regulator activity	enables	IBA	PANTHER:PTN000068596 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
8.	Cloning and characterization of a novel subunit of protein serine/threonine phosphatase 4 from mesangial cells.	Wada T, etal., J Am Soc Nephrol 2001 Dec;12(12):2601-8.

PMID:15489334

Ppp4r1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	112,836,950 - 112,897,490 (+)	NCBI		GRCr8
mRatBN7.2	9	105,391,271 - 105,450,626 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	105,391,412 - 105,450,633 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	113,798,599 - 113,859,120 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	118,905,997 - 118,969,026 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	117,264,559 - 117,324,969 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	113,515,312 - 113,573,308 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	113,534,326 - 113,573,307 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	113,066,545 - 113,105,528 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	104,572,704 - 104,611,601 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	104,782,185 - 104,821,080 (+)	NCBI
Celera	9	102,770,161 - 102,827,110 (+)	NCBI		Celera
Cytogenetic Map	9	q37	NCBI

PPP4R1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	9,546,794 - 9,617,199 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	9,546,791 - 9,615,240 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	18	9,546,792 - 9,614,557 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	9,536,792 - 9,604,600 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	18	9,536,841 - 9,604,567	NCBI
Celera	18	9,431,022 - 9,498,791 (-)	NCBI		Celera
Cytogenetic Map	18	p11.22	NCBI
HuRef	18	9,509,276 - 9,576,873 (-)	NCBI		HuRef
CHM1_1	18	9,546,520 - 9,614,326 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	18	9,710,190 - 9,781,391 (-)	NCBI		T2T-CHM13v2.0

Ppp4r1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	66,089,253 - 66,148,921 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	66,089,568 - 66,148,921 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	65,782,543 - 65,841,926 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	65,782,573 - 65,841,926 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	66,132,695 - 66,191,266 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	65,719,688 - 65,741,389 (+)	NCBI		MGSCv36	mm8
Celera	17	70,106,657 - 70,145,143 (+)	NCBI		Celera
Cytogenetic Map	17	E1.1	NCBI
cM Map	17	35.26	NCBI

Ppp4r1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	2,515,057 - 2,568,860 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955402	2,529,335 - 2,568,621 (+)	NCBI	ChiLan1.0	ChiLan1.0

PPP4R1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	28,835,624 - 28,906,818 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	14,528,218 - 14,599,412 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	4,671,010 - 4,742,301 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	6,957,754 - 7,022,996 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	6,974,934 - 7,022,996 (+)	Ensembl	panpan1.1		panPan2

PPP4R1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	75,524,483 - 75,582,850 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	75,525,249 - 75,583,553 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	74,920,570 - 74,981,437 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	75,583,143 - 75,644,350 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	75,583,161 - 75,644,272 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	75,281,276 - 75,342,393 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	75,298,587 - 75,360,124 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	75,608,737 - 75,670,013 (-)	NCBI		UU_Cfam_GSD_1.0

Ppp4r1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	2,547,917 - 2,597,873 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936626	1,790,837 - 1,826,245 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936626	1,776,194 - 1,826,243 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPP4R1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	98,462,855 - 98,544,477 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	98,462,833 - 98,539,649 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

PPP4R1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	68,417,293 - 68,488,683 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	68,418,292 - 68,488,176 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	43,369,057 - 43,441,048 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppp4r1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624770	18,150,135 - 18,206,898 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624770	18,150,135 - 18,206,835 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ppp4r1
229 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	511
Count of miRNA genes:	260
Interacting mature miRNAs:	316
Transcripts:	ENSRNOT00000066793
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	75712843	111552878	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	77813894	111552878	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat

RH132764

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	105,450,790 - 105,450,983 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	113,573,473 - 113,573,665	NCBI	Rnor6.0
Rnor_5.0	9	113,105,693 - 113,105,885	UniSTS	Rnor5.0
RGSC_v3.4	9	104,611,766 - 104,611,958	UniSTS	RGSC3.4
Celera	9	102,827,275 - 102,827,467	UniSTS
Cytogenetic Map	9	q37	UniSTS

RH139106

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	105,450,826 - 105,450,983 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	113,573,509 - 113,573,665	NCBI	Rnor6.0
Rnor_5.0	9	113,105,729 - 113,105,885	UniSTS	Rnor5.0
RGSC_v3.4	9	104,611,802 - 104,611,958	UniSTS	RGSC3.4
Celera	9	102,827,311 - 102,827,467	UniSTS
Cytogenetic Map	9	q37	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_080907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266612	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010054561	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010054562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF332004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000066793 ⟹ ENSRNOP00000061977

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	105,391,938 - 105,450,625 (+)	Ensembl
Rnor_6.0 Ensembl	9	113,534,326 - 113,573,307 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104139 ⟹ ENSRNOP00000090902

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	105,391,412 - 105,450,633 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111258 ⟹ ENSRNOP00000097964

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	105,408,035 - 105,450,633 (+)	Ensembl

RefSeq Acc Id:

NM_080907 ⟹ NP_543183

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,838,806 - 112,897,490 (+)	NCBI
mRatBN7.2	9	105,391,938 - 105,450,626 (+)	NCBI
Rnor_6.0	9	113,515,312 - 113,573,308 (+)	NCBI
Rnor_5.0	9	113,066,545 - 113,105,528 (+)	NCBI
RGSC_v3.4	9	104,572,704 - 104,611,601 (+)	RGD
Celera	9	102,770,161 - 102,827,110 (+)	RGD

Sequence:

show sequence

CGCCGGCCCGCGCGCGCCCACCGGCTCCCGGCTCGCGCGGCTCGCGGAGCGGGATCCCGGGAGACGAGGAGGCGGGGGCGAGCACAAGATGGCGGACCTCTCGCTGCTCCAGGAGGACCTGCCGGAGG
ACGCGGACGGACTTGGTGTGGATGACTACAGCTCAGAGTCTGATGTGATTATTATACCTTCAGCCCTGGACTTCGTCTCACAAGATGAAATGTTGACACCCTTGGGGAGGCTGGACAAGTATGCTGCA
AGTGAGAACGTCTTTAACAGACAAATGGTGGCCCGGAGTTTGCTGGATACTCTGAGGGAAGTCTGTGGTGAGGAGAGAGACTGCATTGCTGTCTTGGAAAGGATCAGCCGATTGGCTGATGACTCAGA
ACCAACCGTGAGAGCCGAGCTGATGGAACAGGTGCCGCACATCGCACTGTTTTGTCAAGAGAACCGACCTTCCATACCATATGCCTTTTCCAAGTACTTACTGCCAATCGTGGTTAGATACCTTGCAG
ACCAGAATAACCAGGTGAGGAAAACCAGCCAGGCAGCTTTGCTGGCTCTGCTGGAGCAGGAGCTGATTGAGCGACTCGATGTGGAGACCAAGGTGTGCCCCGTCCTCATAGACTTGACTGCCCCAGAC
AGCAATGACGATGTGAAGACAGAGGCCGTGGCTATAATGTGCAAGATGGCCCCCATGGTTGGGAAAGATATTACAGAGCGTCTCATCCTCCCTAGGTTTTGTGAGATGTGCTGTGACTGTAGAATGTT
TCACGTCCGAAAGGTCTGTGCTGCCAATTTTGGAGACATTTGCAGCGTAGTTGGCCAGCAAGCTACAGAAGAAATGCTGCTGCCCAGGTTCTTCCAGCTGTGTTCTGACAATGTGTGGGGCGTCCGGA
AGGCCTGTGCTGAGTGCTTCATGGCCGTCTCCTGCGCGACATGCCAAGAAATCCGACGGACAAAGTTGTCAGCACTGTTTATTAACTTGATCAGTGATCCTTCACGTTGGGTTCGCCAAGCAGCCTTT
CAGTCCCTGGGGCCTTTCATATCCACATTTGCTAATCCATCAAGCTCGGGCCAGTGCTTCAAAGATGAGAGCAAAAGCTCAGAAGACAAAGACAGGATCAGAGACGATGGTGTTGTACAAGAAGAGCA
GAGCAGGCCAGAGGACGCACCTTCAGACCTCAGTGCCCCTCACTCCAGTGCCAGGCTGGACGGCACACTTGAAGGCTGTGCTGCCGAGACGCCTGGGGACTCTGCAGGTGACATGCGTGTTCCAGCGG
ACAGCTCCTTACTCTGTACTTTGTCCTCAGAGTCTCCTCAGGAAGCAGCTAGTGACGCTGAGAGTGGTAAAAAGCACGATAACAACAGCAAGTCTGCGTCCCGGCCAGACGTTGGCACCAGCTCCCCA
GAGCCCACTCCCTTAGATCAGGAAATGTTCAACTCCTTCCATTTCTGGAGGACTCCTCTACCCCAGATAGATCTTGATAAAGAGCTCCAACAGGACCCTGGGGAGAGGCCCAGCCCAGAGAGAACAGG
AGATGCACCTGCAGCCCCTGTACCAGGTTCTCCCAGTATCACCATGGCTACCCGGAAGGAACTAGAAGAAATGATAGAAAACCTAGAGCCGCACATGGATGACCCGGATGTTAAAGCCCAGGTGGAAG
TGCTGTCGGCCGCCCTGCGCGCTTCTACCCTGGATGCTCACGACGAGGCTGGCGGTGCAGAGCAGCGGAGTGAGCTGCAGGACGACGCAGTGGGTGCCGGCGGCGAGCTTCCAAACTGTAGCATCAGC
GAAGACACTTCTGAGCCTCTGGTCATCGCTGCTGAGGAGAATATGGAGGCCACTCCTGACTATATCCATGGAGGTGCGGATGTAGGCCCCGGTGGCGGTGGTGGCTTCAGCCCGGATGAAGAGAGGAG
ACCCAAAGTCCAGGATGTCGTACCACAAGCGTTACTAGACCAGTACCTGTCAATGACCGACCCTTCTCGAGCACAGACAGTCGACACCGAGATCGCTAAGCACTGTGCATACAGTCTGCCGGGTGTGG
CTCTGACCCTTGGCAGACAGAACTGGCACTGCTTGAGAGAGACTTACGAGACCCTAGCGTCAGACATGCAGTGGAAAGTTCGAAGAACTCTGGCCTTCTCCATCCATGAGCTCGCGGTGATTCTCGGG
GACCAGCTGACAGCAGCAGACCTGGTTCCGATTTTTAATGGGTTTTTAAAAGATCTTGACGAAGTCAGGATAGGTGTTCTCAAACACTTGCATGACTTTCTGAAGCTTCTTCATATTGATAAAAGAAG
AGAGTACCTTTATCAACTCCAGGAGTTTTTGGTGACAGACAACAGTAGAAATTGGCGGTTTCGAGCTGAACTGGCAGAACAGCTGATTTTACTTCTAGAATTATATAGTCCCAGAGATGTTTATGATT
ACTTACGTCCCATTGCTCTGAATCTGTGTGCAGACAAAGTTTCTTCAGTCCGTTGGATTTCCTACAAGTTGGTCAGTGAGATGGTGAAGAAGCTACACATGGCGACGCCGCCAACGTTCGGAGTCGAG
CTCATCAATGAGCTGGTGGAGAACTTCGGCAGGTGTCCAAAGTGGTCGGGCCGGCAGGCCTTCGTCTTCGTGTGCCAGACTGTCATTGAGGACGACTGCCTCCCCATGGACCAGTTTGCTGTGCACCT
GATGCCACATTTGCTGACCTTGGCAAATGACAGGGTTCCCAACGTTAGAGTGCTGCTTGCAAAAACCCTTCGACAGACTCTACTAGAGAAAGAATACTTCTTAGCCTCTGCCAGCTGTCATCAGGAGG
CCGTGGAGCAGACAATCATGGCCCTTCAGATGGATCGAGACAGTGACGTCAAGTACTTTGCAAGCATCCACCCGTCCAGTACCAAACTCTCTGAAGACGCAATGAGTACAGCTTCCTCCACCTACTGA
CCCCTGACCCACGGTGTCCTTCCTGCATCCGCGAGAGCCTGGCCTCAGCCGCCTGCGCCACTCGGGACAGCTGTGGTGGTGGGGCCTCCCTCCTGCCAGCTCATTCGCAGGTGCAAGTTGCCTACTCC
CATACCAGTGGTTTTAAGAGTCAAGAGAAAGTACAGTAAACACTATTATCTTATCTTGACTTAGGGAAAGTAAACTCTCAGAGGATTATAATTGTCACCAAAGCCTTAACTCATTACTTCCTCTTCCT
GACTGAATGACTTGAATTGGCAGAGCATTTTCCCTTCGGGAAGGAGGAGGTTCCCAGAGACCTGCGCTGCTTTCTCCTGGTTTTATTTAACGCTGGTAAATGGCATTCTTACCGCCGGAAGGTGGACA
CGCACCGGACAGGGAGGCCTGGGTATTAGCCCAAGCACTTGTCCCAGGTGCGAGTCTGCTCGGCTCCTGGGCTGCCCTGCCCAGCCCTAAGTGTGAATAGTTCTTGGCGTGTATAAATGACAGGAGTT
TTTCCTCTCCTAAGGGCTTGATGTTAACACTAAGTAGAATCTGATTTTGACTCCTAATGCAGCACATTGCTGTACACATTTACAGAATGTTTGCAGACTCTCTCCCGACTCTTTTCATGCTGGTCATG
ACGTGAAGGGGACTTCTCAGCAGATATTGTGTCAGGTGTTCTTAACTTGATCATGGTCAGCTCTGAGGTGCGACTTTCCTTCCCATGCTGCACACCCCTGTGGCCACGCTGGGGCATGCAGCCTTAAT
CATGCTGTTAGAACTGTTGTGGTACAAATTCCAAATAAAATTTATTAATAGGAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039082977 ⟹ XP_038938905

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,852,947 - 112,897,490 (+)	NCBI
mRatBN7.2	9	105,408,011 - 105,449,805 (+)	NCBI

RefSeq Acc Id:

XM_039082978 ⟹ XP_038938906

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,838,869 - 112,897,490 (+)	NCBI
mRatBN7.2	9	105,391,956 - 105,449,805 (+)	NCBI

RefSeq Acc Id:

XM_039082979 ⟹ XP_038938907

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,839,134 - 112,897,490 (+)	NCBI
mRatBN7.2	9	105,392,266 - 105,449,805 (+)	NCBI

RefSeq Acc Id:

XM_039082980 ⟹ XP_038938908

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,838,758 - 112,897,490 (+)	NCBI
mRatBN7.2	9	105,391,884 - 105,449,805 (+)	NCBI

RefSeq Acc Id:

XM_039082981 ⟹ XP_038938909

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,852,946 - 112,897,490 (+)	NCBI
mRatBN7.2	9	105,408,010 - 105,449,805 (+)	NCBI

RefSeq Acc Id:

XM_039082982 ⟹ XP_038938910

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,836,950 - 112,897,490 (+)	NCBI
mRatBN7.2	9	105,391,271 - 105,450,626 (+)	NCBI

RefSeq Acc Id:

XM_039082983 ⟹ XP_038938911

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,852,953 - 112,897,490 (+)	NCBI
mRatBN7.2	9	105,408,014 - 105,449,805 (+)	NCBI

RefSeq Acc Id:

XM_039082984 ⟹ XP_038938912

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,838,388 - 112,897,490 (+)	NCBI
mRatBN7.2	9	105,391,522 - 105,449,805 (+)	NCBI

RefSeq Acc Id:

XM_039082985 ⟹ XP_038938913

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,852,949 - 112,897,490 (+)	NCBI
mRatBN7.2	9	105,408,012 - 105,449,805 (+)	NCBI

RefSeq Acc Id:

XM_063266612 ⟹ XP_063122682

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,838,557 - 112,879,255 (+)	NCBI

RefSeq Acc Id:

XR_010054561

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,838,555 - 112,889,173 (+)	NCBI

RefSeq Acc Id:

XR_010054562

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,838,556 - 112,887,500 (+)	NCBI


Protein RefSeqs	NP_543183	(Get FASTA)	NCBI Sequence Viewer
	XP_038938905	(Get FASTA)	NCBI Sequence Viewer
	XP_038938906	(Get FASTA)	NCBI Sequence Viewer
	XP_038938907	(Get FASTA)	NCBI Sequence Viewer
	XP_038938908	(Get FASTA)	NCBI Sequence Viewer
	XP_038938909	(Get FASTA)	NCBI Sequence Viewer
	XP_038938910	(Get FASTA)	NCBI Sequence Viewer
	XP_038938911	(Get FASTA)	NCBI Sequence Viewer
	XP_038938912	(Get FASTA)	NCBI Sequence Viewer
	XP_038938913	(Get FASTA)	NCBI Sequence Viewer
	XP_063122682	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61726	(Get FASTA)	NCBI Sequence Viewer
	AAL37490	(Get FASTA)	NCBI Sequence Viewer
	EDL91809	(Get FASTA)	NCBI Sequence Viewer
	EDL91810	(Get FASTA)	NCBI Sequence Viewer
	EDL91811	(Get FASTA)	NCBI Sequence Viewer
	EDL91812	(Get FASTA)	NCBI Sequence Viewer
	EDL91813	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000061977
	ENSRNOP00000090902
	ENSRNOP00000097964
	ENSRNOP00000109427
GenBank Protein	Q8VI02	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_543183 ⟸ NM_080907

- UniProtKB:

Q8VI02 (UniProtKB/Swiss-Prot), F1LRK9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MADLSLLQEDLPEDADGLGVDDYSSESDVIIIPSALDFVSQDEMLTPLGRLDKYAASENVFNRQMVARSLLDTLREVCGEERDCIAVLERISRLADDSEPTVRAELMEQVPHIALFCQENRPSIPYAF
SKYLLPIVVRYLADQNNQVRKTSQAALLALLEQELIERLDVETKVCPVLIDLTAPDSNDDVKTEAVAIMCKMAPMVGKDITERLILPRFCEMCCDCRMFHVRKVCAANFGDICSVVGQQATEEMLLPR
FFQLCSDNVWGVRKACAECFMAVSCATCQEIRRTKLSALFINLISDPSRWVRQAAFQSLGPFISTFANPSSSGQCFKDESKSSEDKDRIRDDGVVQEEQSRPEDAPSDLSAPHSSARLDGTLEGCAAE
TPGDSAGDMRVPADSSLLCTLSSESPQEAASDAESGKKHDNNSKSASRPDVGTSSPEPTPLDQEMFNSFHFWRTPLPQIDLDKELQQDPGERPSPERTGDAPAAPVPGSPSITMATRKELEEMIENLE
PHMDDPDVKAQVEVLSAALRASTLDAHDEAGGAEQRSELQDDAVGAGGELPNCSISEDTSEPLVIAAEENMEATPDYIHGGADVGPGGGGGFSPDEERRPKVQDVVPQALLDQYLSMTDPSRAQTVDT
EIAKHCAYSLPGVALTLGRQNWHCLRETYETLASDMQWKVRRTLAFSIHELAVILGDQLTAADLVPIFNGFLKDLDEVRIGVLKHLHDFLKLLHIDKRREYLYQLQEFLVTDNSRNWRFRAELAEQLI
LLLELYSPRDVYDYLRPIALNLCADKVSSVRWISYKLVSEMVKKLHMATPPTFGVELINELVENFGRCPKWSGRQAFVFVCQTVIEDDCLPMDQFAVHLMPHLLTLANDRVPNVRVLLAKTLRQTLLE
KEYFLASASCHQEAVEQTIMALQMDRDSDVKYFASIHPSSTKLSEDAMSTASSTY

hide sequence

Ensembl Acc Id:

ENSRNOP00000061977 ⟸ ENSRNOT00000066793

RefSeq Acc Id:	XP_038938910 ⟸ XM_039082982
- Peptide Label:	isoform X6
- UniProtKB:	A0A8I6ACS7 (UniProtKB/TrEMBL), A6JRC6 (UniProtKB/TrEMBL), A0A8I6AX20 (UniProtKB/TrEMBL), A6JRC4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038938912 ⟸ XM_039082984
- Peptide Label:	isoform X6
- UniProtKB:	A0A8I6ACS7 (UniProtKB/TrEMBL), A6JRC6 (UniProtKB/TrEMBL), A0A8I6AX20 (UniProtKB/TrEMBL), A6JRC4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038938908 ⟸ XM_039082980
- Peptide Label:	isoform X4
- UniProtKB:	F1LRK9 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8VI02-F1-model_v2	AlphaFold	Q8VI02	1-951	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-26483	BioCyc
Ensembl Genes	ENSRNOG00000013733	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000066793	ENTREZGENE
	ENSRNOT00000104139	ENTREZGENE
	ENSRNOT00000111258	ENTREZGENE
	ENSRNOT00000139243	ENTREZGENE
Gene3D-CATH	1.25.10.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5598703	IMAGE-MGC_LOAD
InterPro	ARM-like	UniProtKB/Swiss-Prot
	ARM-type_fold	UniProtKB/Swiss-Prot
	HEAT	UniProtKB/Swiss-Prot
	HEAT_type_2	UniProtKB/Swiss-Prot
	PP2A_Regulatory_Subunit_A	UniProtKB/Swiss-Prot
KEGG Report	rno:140943	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72329	IMAGE-MGC_LOAD
NCBI Gene	140943	ENTREZGENE
PANTHER	PTHR10648:SF8	UniProtKB/Swiss-Prot
	SERINE/THREONINE-PROTEIN PHOSPHATASE PP2A 65 KDA REGULATORY SUBUNIT	UniProtKB/Swiss-Prot
Pfam	HEAT	UniProtKB/Swiss-Prot
PhenoGen	Ppp4r1	PhenoGen
PROSITE	HEAT_REPEAT	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000013733	RatGTEx
Superfamily-SCOP	SSF48371	UniProtKB/Swiss-Prot
UniProt	A0A8I6ACS7	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AX20	ENTREZGENE, UniProtKB/TrEMBL
	A6JRC4	ENTREZGENE, UniProtKB/TrEMBL
	A6JRC5_RAT	UniProtKB/TrEMBL
	A6JRC6	ENTREZGENE, UniProtKB/TrEMBL
	A6JRC7_RAT	UniProtKB/TrEMBL
	A6JRC8_RAT	UniProtKB/TrEMBL
	F1LRK9	ENTREZGENE, UniProtKB/TrEMBL
	PP4R1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Ppp4r1	protein phosphatase 4, regulatory subunit 1			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Ppp4r1	protein phosphatase 4, regulatory subunit 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar