Symbol:
Gjb1
Name:
gap junction protein, beta 1
RGD ID:
61926
Description:
Enables gap junction channel activity. Involved in epididymis development and purine ribonucleotide transport. Located in gap junction and lateral plasma membrane. Part of protein-containing complex. Biomarker of autoimmune thyroiditis and extrahepatic cholestasis. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease X-linked dominant 1. Orthologous to human GJB1 (gap junction protein beta 1); INTERACTS WITH (+)-schisandrin B; 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
connexin 32; connexin g; connexin-32; Cx32; Cxng; GAP junction 28 kDa liver protein; gap junction beta-1 protein; gap junction membrane channel protein beta 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 70,541,845 - 70,549,776 (+) NCBI GRCr8 mRatBN7.2 X 66,501,848 - 66,509,783 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 66,501,820 - 66,509,925 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 67,985,201 - 67,993,132 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 71,485,591 - 71,493,522 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 69,046,498 - 69,054,429 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 71,272,030 - 71,279,973 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 71,272,042 - 71,279,977 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 72,123,958 - 72,131,901 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 89,448,873 - 89,456,812 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 89,522,360 - 89,530,242 (+) NCBI Celera X 66,857,755 - 66,865,686 (+) NCBI Celera Cytogenetic Map X q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gjb1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GJB1 mRNA] CTD PMID:31150632 Gjb1 Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in decreased expression of GJB1 mRNA CTD PMID:27840820 Gjb1 Rat 1,2-dimethylhydrazine increases expression ISO Gjb1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of GJB1 mRNA CTD PMID:22206623 Gjb1 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of GJB1 mRNA CTD PMID:17522070 Gjb1 Rat 17beta-estradiol decreases expression ISO GJB1 (Homo sapiens) 6480464 Estradiol results in decreased expression of GJB1 mRNA CTD PMID:20106945 Gjb1 Rat 17beta-estradiol increases expression ISO Gjb1 (Mus musculus) 6480464 Estradiol results in increased expression of GJB1 mRNA CTD PMID:39298647 Gjb1 Rat 17beta-estradiol multiple interactions EXP 6480464 Estradiol affects the reaction [Hexachlorobenzene results in increased expression of GJB1 mRNA] CTD PMID:12117784 Gjb1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Gjb1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of GJB1 mRNA CTD PMID:19770486 Gjb1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gjb1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GJB1 mRNA CTD PMID:21570461 Gjb1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GJB1 mRNA and Tetrachlorodibenzodioxin results in decreased expression of GJB1 protein CTD PMID:12419834 and PMID:21215274 Gjb1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Gjb1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Gjb1 Rat 2-acetamidofluorene decreases expression EXP 6480464 2-Acetylaminofluorene results in decreased expression of GJB1 mRNA CTD PMID:2559087 Gjb1 Rat 2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one decreases expression ISO Gjb1 (Mus musculus) 6480464 Itraconazole results in decreased expression of GJB1 mRNA CTD PMID:31099283 Gjb1 Rat 4,4'-sulfonyldiphenol increases expression ISO Gjb1 (Mus musculus) 6480464 bisphenol S results in increased expression of GJB1 mRNA CTD PMID:39298647 Gjb1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Gjb1 (Mus musculus) 6480464 bisphenol S results in decreased methylation of GJB1 promoter CTD PMID:33297965 Gjb1 Rat 4-hydroxyphenyl retinamide increases expression ISO Gjb1 (Mus musculus) 6480464 Fenretinide results in increased expression of GJB1 mRNA CTD PMID:28973697 Gjb1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO GJB1 (Homo sapiens) 6480464 [[Decitabine affects the methylation of GJB1 promoter] which affects the expression of GJB1 mRNA] which affects the activity of SRC protein CTD PMID:18264126 Gjb1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of GJB1 mRNA CTD PMID:19483382 Gjb1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of GJB1 mRNA CTD PMID:19483382 Gjb1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GJB1 mRNA CTD PMID:24780913 and PMID:25825206 Gjb1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of GJB1 mRNA CTD PMID:31881176 Gjb1 Rat aflatoxin B1 affects expression ISO GJB1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of GJB1 protein CTD PMID:20106945 Gjb1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of GJB1 mRNA CTD PMID:33354967 Gjb1 Rat aflatoxin B1 decreases methylation ISO GJB1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of GJB1 promoter CTD PMID:30157460 Gjb1 Rat aflatoxin B1 decreases expression ISO GJB1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of GJB1 mRNA CTD PMID:22100608 and PMID:27153756 Gjb1 Rat aflatoxin B1 decreases expression ISO Gjb1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of GJB1 mRNA CTD PMID:19770486 Gjb1 Rat Aflatoxin B2 alpha increases methylation ISO GJB1 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of GJB1 intron CTD PMID:30157460 Gjb1 Rat all-trans-retinoic acid increases expression ISO GJB1 (Homo sapiens) 6480464 Tretinoin results in increased expression of GJB1 mRNA CTD PMID:16029656 Gjb1 Rat all-trans-retinoic acid multiple interactions ISO Gjb1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of GJB1 mRNA CTD PMID:36189433 Gjb1 Rat all-trans-retinoic acid increases expression ISO Gjb1 (Mus musculus) 6480464 Tretinoin results in increased expression of GJB1 mRNA CTD PMID:36189433 Gjb1 Rat all-trans-retinoic acid multiple interactions ISO GJB1 (Homo sapiens) 6480464 Tretinoin promotes the reaction [[GJB1 protein co-treated with GJB2 protein] promotes the reaction [Cisplatin results in increased activity of CASP3 protein]] and Tretinoin promotes the reaction [[GJB1 protein co-treated with GJB2 protein] promotes the reaction [Cisplatin results in increased activity of CASP9 protein]] CTD PMID:23747833 Gjb1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of GJB1 mRNA CTD PMID:19483382 Gjb1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GJB1 mRNA CTD PMID:16483693 Gjb1 Rat ammonium chloride increases expression EXP 6480464 Ammonium Chloride results in increased expression of GJB1 protein CTD PMID:16483693 Gjb1 Rat atazanavir sulfate multiple interactions ISO GJB1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in decreased expression of GJB1 mRNA CTD PMID:33819548 Gjb1 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of GJB1 mRNA CTD PMID:22153302 Gjb1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of GJB1 mRNA CTD PMID:19483382 Gjb1 Rat benzene affects response to substance ISO Gjb1 (Mus musculus) 6480464 GJB1 protein affects the susceptibility to Benzene CTD PMID:14698565 Gjb1 Rat benzo[a]pyrene decreases expression ISO GJB1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of GJB1 mRNA CTD PMID:22316170 more ... Gjb1 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of GJB1 mRNA CTD PMID:34283317 Gjb1 Rat benzo[a]pyrene decreases methylation ISO GJB1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of GJB1 3' UTR CTD PMID:27901495 Gjb1 Rat benzo[a]pyrene multiple interactions ISO Gjb1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GJB1 mRNA CTD PMID:27858113 Gjb1 Rat benzo[b]fluoranthene multiple interactions ISO Gjb1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GJB1 mRNA CTD PMID:27858113 Gjb1 Rat benzo[e]pyrene increases methylation ISO GJB1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of GJB1 intron CTD PMID:30157460 Gjb1 Rat beta-lapachone decreases expression ISO GJB1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of GJB1 mRNA CTD PMID:38218311 Gjb1 Rat bis(2-chloroethyl) sulfide increases expression ISO Gjb1 (Mus musculus) 6480464 Mustard Gas results in increased expression of GJB1 mRNA CTD PMID:15674843 Gjb1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GJB1 mRNA CTD PMID:25181051 Gjb1 Rat bisphenol A increases expression ISO Gjb1 (Mus musculus) 6480464 bisphenol A results in increased expression of GJB1 mRNA CTD PMID:34585602 Gjb1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GJB1 mRNA CTD PMID:30903817 Gjb1 Rat bisphenol A affects expression ISO GJB1 (Homo sapiens) 6480464 bisphenol A affects the expression of GJB1 mRNA CTD PMID:30903817 Gjb1 Rat bisphenol F increases expression ISO Gjb1 (Mus musculus) 6480464 bisphenol F results in increased expression of GJB1 mRNA CTD PMID:36706583 Gjb1 Rat buta-1,3-diene decreases expression ISO Gjb1 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of GJB1 mRNA CTD PMID:29038090 Gjb1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of GJB1 mRNA CTD PMID:19167457 Gjb1 Rat cadmium dichloride increases expression ISO Gjb1 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of GJB1 mRNA CTD PMID:34666113 Gjb1 Rat carbon nanotube increases expression ISO Gjb1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Gjb1 Rat CGP 52608 multiple interactions ISO GJB1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GJB1 gene] CTD PMID:28238834 Gjb1 Rat chenodeoxycholic acid multiple interactions ISO GJB1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of GJB1 mRNA more ... CTD PMID:33819548 Gjb1 Rat chlorendic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with chlorendic acid] results in decreased expression of GJB1 protein and [Ethylnitrosourea co-treated with chlorendic acid] results in decreased expression of GJB1 protein CTD PMID:1973356 Gjb1 Rat chloroform decreases expression EXP 6480464 Chloroform results in decreased expression of GJB1 mRNA CTD PMID:17522070 Gjb1 Rat cholesterol decreases abundance ISO Gjb1 (Mus musculus) 6480464 GJB1 protein results in decreased abundance of Cholesterol CTD PMID:27859493 Gjb1 Rat choline multiple interactions ISO Gjb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GJB1 gene and GJB1 protein results in decreased susceptibility to [Choline deficiency co-treated with Dietary Fats] CTD PMID:20938992 and PMID:27859493 Gjb1 Rat chrysene multiple interactions ISO Gjb1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GJB1 mRNA CTD PMID:27858113 Gjb1 Rat ciguatoxin CTX1B affects expression ISO Gjb1 (Mus musculus) 6480464 Ciguatoxins affects the expression of GJB1 mRNA CTD PMID:18353800 Gjb1 Rat ciprofibrate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with ciprofibrate] results in decreased expression of GJB1 protein and [Ethylnitrosourea co-treated with ciprofibrate] results in decreased expression of GJB1 protein CTD PMID:1973356 Gjb1 Rat cisplatin multiple interactions ISO GJB1 (Homo sapiens) 6480464 [GJB1 protein co-treated with GJB2 protein] promotes the reaction [Cisplatin results in increased activity of CASP3 protein] more ... CTD PMID:23747833 Gjb1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of GJB1 mRNA and Clofibrate affects the expression of GJB1 protein CTD PMID:19483382 and PMID:8968061 Gjb1 Rat clofibrate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibrate] results in increased expression of GJB1 protein CTD PMID:10550479 Gjb1 Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of GJB1 protein CTD PMID:8597128 Gjb1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of GJB1 mRNA CTD PMID:24386269 Gjb1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of GJB1 mRNA and Cocaine affects the expression of GJB1 protein CTD PMID:10510198 Gjb1 Rat copper(II) sulfate decreases expression ISO GJB1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of GJB1 mRNA CTD PMID:19549813 Gjb1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of GJB1 mRNA CTD PMID:26577399 Gjb1 Rat cyclophosphamide decreases expression ISO Gjb1 (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of GJB1 mRNA CTD PMID:21621594 Gjb1 Rat cyclosporin A increases expression ISO Gjb1 (Mus musculus) 6480464 Cyclosporine results in increased expression of GJB1 mRNA CTD PMID:21621594 Gjb1 Rat cyclosporin A multiple interactions ISO GJB1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in decreased expression of GJB1 mRNA CTD PMID:33819548 Gjb1 Rat cyclosporin A decreases methylation ISO GJB1 (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of GJB1 promoter CTD PMID:27989131 Gjb1 Rat cyclosporin A decreases expression ISO GJB1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GJB1 mRNA CTD PMID:20106945 more ... Gjb1 Rat cylindrospermopsin decreases expression ISO GJB1 (Homo sapiens) 6480464 cylindrospermopsin results in decreased expression of GJB1 mRNA CTD PMID:30500929 Gjb1 Rat DDT multiple interactions EXP 6480464 [DDT co-treated with Diethylnitrosamine] results in decreased expression of GJB1 mRNA and [DDT co-treated with Diethylnitrosamine] results in increased expression of GJB1 mRNA CTD PMID:15885732 Gjb1 Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of GJB1 protein CTD PMID:8242434 Gjb1 Rat deoxycholic acid multiple interactions ISO GJB1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of GJB1 mRNA more ... CTD PMID:33819548 Gjb1 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of GJB1 mRNA CTD PMID:17522070 Gjb1 Rat dexamethasone increases expression ISO Gjb1 (Mus musculus) 6480464 Dexamethasone results in increased expression of GJB1 mRNA CTD PMID:21621594 Gjb1 Rat dimethyl sulfoxide increases expression EXP 6480464 Dimethyl Sulfoxide results in increased expression of GJB1 mRNA CTD PMID:8631141 Gjb1 Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of GJB1 mRNA CTD PMID:17481689 Gjb1 Rat diquat increases expression ISO Gjb1 (Mus musculus) 6480464 Diquat results in increased expression of GJB1 mRNA and Diquat results in increased expression of GJB1 protein CTD PMID:36851058 Gjb1 Rat elemental selenium increases expression ISO GJB1 (Homo sapiens) 6480464 Selenium results in increased expression of GJB1 mRNA CTD PMID:19244175 Gjb1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of GJB1 mRNA CTD PMID:29391264 Gjb1 Rat entinostat decreases expression ISO GJB1 (Homo sapiens) 6480464 entinostat results in decreased expression of GJB1 mRNA CTD PMID:27188386 Gjb1 Rat fluoranthene decreases expression EXP 6480464 fluoranthene results in decreased expression of GJB1 protein CTD PMID:25268939 Gjb1 Rat fluoranthene multiple interactions ISO Gjb1 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] affects the expression of and affects the activity of GJB1 protein more ... CTD PMID:28329830 Gjb1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of GJB1 mRNA CTD PMID:24793618 Gjb1 Rat folic acid multiple interactions ISO Gjb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GJB1 gene CTD PMID:20938992 Gjb1 Rat folic acid decreases expression ISO GJB1 (Homo sapiens) 6480464 Folic Acid results in decreased expression of GJB1 mRNA CTD PMID:21867686 Gjb1 Rat FR900359 decreases phosphorylation ISO GJB1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of GJB1 protein CTD PMID:37730182 Gjb1 Rat fucoxanthin increases expression ISO GJB1 (Homo sapiens) 6480464 fucoxanthin results in increased expression of GJB1 mRNA and fucoxanthin results in increased expression of GJB1 protein CTD PMID:19737546 Gjb1 Rat gliotoxin decreases expression EXP 6480464 Gliotoxin results in decreased expression of GJB1 mRNA CTD PMID:18346771 Gjb1 Rat glycochenodeoxycholic acid multiple interactions ISO GJB1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of GJB1 mRNA more ... CTD PMID:33819548 Gjb1 Rat glycocholic acid multiple interactions ISO GJB1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of GJB1 mRNA more ... CTD PMID:33819548 Gjb1 Rat glycodeoxycholic acid multiple interactions ISO GJB1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of GJB1 mRNA more ... CTD PMID:33819548 Gjb1 Rat hexachlorobenzene multiple interactions EXP 6480464 AKT1 protein promotes the reaction [Hexachlorobenzene results in decreased expression of GJB1 mRNA] more ... CTD PMID:12117784 and PMID:17150971 Gjb1 Rat hexachlorobenzene decreases expression EXP 6480464 Hexachlorobenzene results in decreased expression of GJB1 mRNA and Hexachlorobenzene results in decreased expression of GJB1 protein CTD PMID:12117784 and PMID:17150971 Gjb1 Rat hydrogen peroxide affects expression ISO GJB1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of GJB1 protein CTD PMID:21179406 Gjb1 Rat itraconazole decreases expression ISO Gjb1 (Mus musculus) 6480464 Itraconazole results in decreased expression of GJB1 mRNA CTD PMID:31099283 Gjb1 Rat ketoconazole decreases expression ISO Gjb1 (Mus musculus) 6480464 Ketoconazole results in decreased expression of GJB1 mRNA CTD PMID:31099283 Gjb1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of GJB1 mRNA CTD PMID:19483382 Gjb1 Rat L-methionine multiple interactions ISO Gjb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GJB1 gene CTD PMID:20938992 Gjb1 Rat linoleic acid increases abundance ISO Gjb1 (Mus musculus) 6480464 GJB1 protein results in increased abundance of Linoleic Acid CTD PMID:27859493 Gjb1 Rat LY294002 multiple interactions EXP 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [GJB1 protein results in decreased expression of IL1B protein] CTD PMID:15350541 Gjb1 Rat malonaldehyde decreases abundance ISO Gjb1 (Mus musculus) 6480464 GJB1 protein results in decreased abundance of Malondialdehyde CTD PMID:27859493 Gjb1 Rat mercury dichloride increases expression ISO GJB1 (Homo sapiens) 6480464 Mercuric Chloride results in increased expression of GJB1 mRNA and Mercuric Chloride results in increased expression of GJB1 protein CTD PMID:18409822 Gjb1 Rat mercury dichloride decreases expression EXP 6480464 Mercuric Chloride results in decreased expression of GJB1 mRNA CTD PMID:16507785 Gjb1 Rat methapyrilene increases methylation ISO GJB1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of GJB1 intron CTD PMID:30157460 Gjb1 Rat methylarsonic acid increases expression EXP 6480464 monomethylarsonic acid results in increased expression of GJB1 mRNA CTD PMID:17481689 Gjb1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Gjb1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of GJB1 mRNA CTD PMID:36189433 Gjb1 Rat N-acetyl-L-cysteine multiple interactions ISO Gjb1 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [2-chloroethyl ethyl sulfide results in decreased expression of GJB1 mRNA] CTD PMID:32142722 Gjb1 Rat N-ethyl-N-(2-hydroxyethyl)nitrosamine decreases expression EXP 6480464 N-ethyl-N-hydroxyethylnitrosamine results in decreased expression of GJB1 mRNA CTD PMID:2559087 Gjb1 Rat N-ethyl-N-nitrosourea multiple interactions EXP 6480464 [Ethylnitrosourea co-treated with chlorendic acid] results in decreased expression of GJB1 protein more ... CTD PMID:1973356 Gjb1 Rat N-methyl-N-nitrosourea decreases response to substance ISO Gjb1 (Mus musculus) 6480464 GJB1 protein results in decreased susceptibility to Methylnitrosourea CTD PMID:17463168 Gjb1 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of GJB1 mRNA CTD PMID:2559087 Gjb1 Rat N-nitrosodiethylamine multiple interactions ISO Gjb1 (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of and affects the localization of GJB1 protein and mitoquinone inhibits the reaction [Diethylnitrosamine results in decreased expression of and affects the localization of GJB1 protein] CTD PMID:36037915 Gjb1 Rat N-nitrosodiethylamine decreases response to substance EXP 6480464 GJB1 protein results in decreased susceptibility to Diethylnitrosamine CTD PMID:22569583 Gjb1 Rat N-nitrosodiethylamine affects response to substance ISO Gjb1 (Mus musculus) 6480464 GJB1 protein affects the susceptibility to Diethylnitrosamine CTD PMID:11376700 more ... Gjb1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [DDT co-treated with Diethylnitrosamine] results in decreased expression of GJB1 mRNA more ... CTD PMID:10550479 more ... Gjb1 Rat N-nitrosodiethylamine affects response to substance EXP 6480464 GJB1 protein affects the susceptibility to Diethylnitrosamine CTD PMID:16243774 Gjb1 Rat N-nitrosodimethylamine multiple interactions EXP 6480464 [Dietary Fats co-treated with Dimethylnitrosamine] results in decreased expression of GJB1 protein more ... CTD PMID:32833043 Gjb1 Rat nefazodone multiple interactions ISO GJB1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in decreased expression of GJB1 mRNA CTD PMID:33819548 Gjb1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of GJB1 mRNA CTD PMID:22110744 Gjb1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of GJB1 mRNA CTD PMID:33484710 Gjb1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of GJB1 mRNA CTD PMID:16857307 and PMID:19237604 Gjb1 Rat oleamide multiple interactions ISO GJB1 (Homo sapiens) 6480464 oleylamide inhibits the reaction [[GJB1 protein co-treated with GJB2 protein] promotes the reaction [Cisplatin results in increased activity of CASP3 protein]] and oleylamide inhibits the reaction [[GJB1 protein co-treated with GJB2 protein] promotes the reaction [Cisplatin results in increased activity of CASP9 protein]] CTD PMID:23747833 Gjb1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of GJB1 mRNA CTD PMID:19483382 Gjb1 Rat paracetamol affects expression ISO Gjb1 (Mus musculus) 6480464 Acetaminophen affects the expression of GJB1 mRNA CTD PMID:17562736 Gjb1 Rat paracetamol multiple interactions ISO GJB1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of GJB1 mRNA CTD PMID:33819548 Gjb1 Rat paracetamol decreases expression ISO Gjb1 (Mus musculus) 6480464 Acetaminophen results in decreased expression of GJB1 mRNA and Acetaminophen results in decreased expression of GJB1 protein CTD PMID:26912412 Gjb1 Rat paracetamol affects localization EXP 6480464 Acetaminophen affects the localization of GJB1 protein CTD PMID:20097795 Gjb1 Rat paracetamol increases response to substance EXP 6480464 GJB1 protein results in increased susceptibility to Acetaminophen CTD PMID:20097795 Gjb1 Rat paracetamol decreases expression ISO GJB1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GJB1 mRNA CTD PMID:21420995 and PMID:29067470 Gjb1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of GJB1 mRNA CTD PMID:17522070 and PMID:18346771 Gjb1 Rat paraquat decreases expression ISO Gjb1 (Mus musculus) 6480464 Paraquat results in decreased expression of GJB1 mRNA CTD PMID:16797015 Gjb1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of GJB1 mRNA CTD PMID:32680482 Gjb1 Rat pentachlorophenol increases expression ISO Gjb1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of GJB1 mRNA CTD PMID:23892564 Gjb1 Rat pentobarbital decreases expression EXP 6480464 Pentobarbital results in decreased expression of GJB1 protein CTD PMID:8205533 Gjb1 Rat perfluorononanoic acid decreases expression ISO GJB1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of GJB1 mRNA CTD PMID:32588087 Gjb1 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of GJB1 mRNA CTD PMID:35163327 Gjb1 Rat phenanthrene decreases expression EXP 6480464 phenanthrene results in decreased expression of GJB1 protein CTD PMID:25268939 Gjb1 Rat phenethyl caffeate multiple interactions EXP 6480464 caffeic acid phenethyl ester inhibits the reaction [GJB1 protein results in decreased expression of IL1B mRNA] and caffeic acid phenethyl ester inhibits the reaction [GJB1 protein results in decreased expression of IL1B protein] CTD PMID:15350541 Gjb1 Rat phenobarbital affects response to substance ISO Gjb1 (Mus musculus) 6480464 GJB1 affects the susceptibility to Phenobarbital CTD PMID:11016633 Gjb1 Rat phenobarbital multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of GJB1 protein and [Ethylnitrosourea co-treated with Phenobarbital] results in decreased expression of GJB1 protein CTD PMID:1973356 Gjb1 Rat phenobarbital increases response to substance ISO Gjb1 (Mus musculus) 6480464 GJB1 protein results in increased susceptibility to Phenobarbital CTD PMID:18308698 Gjb1 Rat pirinixic acid increases expression ISO Gjb1 (Mus musculus) 6480464 pirinixic acid results in increased expression of GJB1 mRNA CTD PMID:17426115 Gjb1 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of GJB1 protein CTD PMID:17624652 Gjb1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of GJB1 mRNA CTD PMID:19483382 Gjb1 Rat pirinixic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with pirinixic acid] results in decreased expression of GJB1 protein and [Ethylnitrosourea co-treated with pirinixic acid] results in decreased expression of GJB1 protein CTD PMID:1973356 Gjb1 Rat pirinixic acid decreases expression ISO Gjb1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of GJB1 mRNA CTD PMID:18445702 Gjb1 Rat prednisolone increases expression ISO Gjb1 (Mus musculus) 6480464 Prednisolone results in increased expression of GJB1 mRNA CTD PMID:21621594 Gjb1 Rat propanal decreases expression ISO GJB1 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of GJB1 mRNA CTD PMID:26079696 Gjb1 Rat pyrene decreases expression EXP 6480464 pyrene results in decreased expression of GJB1 protein CTD PMID:25268939 Gjb1 Rat quercetin decreases expression ISO GJB1 (Homo sapiens) 6480464 Quercetin results in decreased expression of GJB1 mRNA CTD PMID:21632981 Gjb1 Rat SB 203580 multiple interactions ISO Gjb1 (Mus musculus) 6480464 SB 203580 inhibits the reaction [1-methylanthracene affects the expression of and affects the activity of GJB1 protein] more ... CTD PMID:28329830 Gjb1 Rat selenium atom increases expression ISO GJB1 (Homo sapiens) 6480464 Selenium results in increased expression of GJB1 mRNA CTD PMID:19244175 Gjb1 Rat silicon dioxide decreases expression ISO GJB1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of GJB1 mRNA CTD PMID:25895662 Gjb1 Rat sodium arsenite decreases expression ISO GJB1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GJB1 mRNA CTD PMID:29301061 Gjb1 Rat sodium arsenite decreases expression ISO Gjb1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of GJB1 mRNA CTD PMID:37682722 Gjb1 Rat sodium dodecyl sulfate decreases expression ISO Gjb1 (Mus musculus) 6480464 Sodium Dodecyl Sulfate results in decreased expression of GJB1 mRNA CTD PMID:21621594 Gjb1 Rat tacrolimus hydrate increases expression ISO Gjb1 (Mus musculus) 6480464 Tacrolimus results in increased expression of GJB1 mRNA CTD PMID:21621594 Gjb1 Rat tamoxifen multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Tamoxifen] results in decreased expression of GJB1 protein and [Ethylnitrosourea co-treated with Tamoxifen] results in decreased expression of GJB1 protein CTD PMID:1973356 Gjb1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of GJB1 mRNA and Carbon Tetrachloride results in decreased expression of GJB1 protein CTD PMID:17522070 more ... Gjb1 Rat tetrachloromethane decreases expression ISO Gjb1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of GJB1 mRNA CTD PMID:31919559 Gjb1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GJB1 mRNA] CTD PMID:31150632 Gjb1 Rat tetrachloromethane affects response to substance ISO Gjb1 (Mus musculus) 6480464 GJB1 protein affects the susceptibility to Carbon Tetrachloride CTD PMID:27268753 Gjb1 Rat tetrachloromethane multiple interactions ISO Gjb1 (Mus musculus) 6480464 [GJB1 protein affects the susceptibility to Carbon Tetrachloride] which affects the activity of CAT protein more ... CTD PMID:27268753 Gjb1 Rat tetraphene multiple interactions ISO Gjb1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GJB1 mRNA CTD PMID:27858113 Gjb1 Rat Theaflavin 3,3'-digallate affects expression ISO GJB1 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of GJB1 mRNA CTD PMID:34925699 Gjb1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of GJB1 mRNA CTD PMID:19483382 Gjb1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of GJB1 protein CTD PMID:15350541 Gjb1 Rat titanium dioxide increases methylation ISO Gjb1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of GJB1 gene CTD PMID:35295148 Gjb1 Rat trimethylarsine oxide increases expression EXP 6480464 trimethylarsine oxide results in increased expression of GJB1 mRNA CTD PMID:17481689 Gjb1 Rat urethane decreases expression ISO Gjb1 (Mus musculus) 6480464 Urethane results in decreased expression of GJB1 mRNA and Urethane results in decreased expression of GJB1 protein CTD PMID:16926031 Gjb1 Rat urethane decreases expression ISO GJB1 (Homo sapiens) 6480464 Urethane results in decreased expression of GJB1 mRNA CTD PMID:28818685 Gjb1 Rat valproic acid decreases expression ISO GJB1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GJB1 mRNA CTD PMID:29154799 Gjb1 Rat vancomycin increases expression ISO Gjb1 (Mus musculus) 6480464 Vancomycin results in increased expression of GJB1 mRNA CTD PMID:18930951 Gjb1 Rat zearalenone decreases expression ISO Gjb1 (Mus musculus) 6480464 Zearalenone results in decreased expression of GJB1 protein CTD PMID:27473017 Gjb1 Rat zoledronic acid decreases expression ISO GJB1 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of GJB1 mRNA CTD PMID:24714768
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (EXP,ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-acetamidofluorene (EXP) 2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) ammonium chloride (EXP) atazanavir sulfate (ISO) atrazine (EXP) benzbromarone (EXP) benzene (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) C60 fullerene (EXP) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chlorendic acid (EXP) chloroform (EXP) cholesterol (ISO) choline (ISO) chrysene (ISO) ciguatoxin CTX1B (ISO) ciprofibrate (EXP) cisplatin (ISO) clofibrate (EXP) cobalt dichloride (EXP) cocaine (EXP) copper(II) sulfate (ISO) Cuprizon (EXP) cyclophosphamide (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) DDT (EXP) deoxycholic acid (ISO) dexamethasone (EXP,ISO) dimethyl sulfoxide (EXP) dimethylarsinic acid (EXP) diquat (ISO) elemental selenium (ISO) endosulfan (EXP) entinostat (ISO) fluoranthene (EXP,ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fucoxanthin (ISO) gliotoxin (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) hexachlorobenzene (EXP) hydrogen peroxide (ISO) itraconazole (ISO) ketoconazole (ISO) L-ethionine (EXP) L-methionine (ISO) linoleic acid (ISO) LY294002 (EXP) malonaldehyde (ISO) mercury dichloride (EXP,ISO) methapyrilene (ISO) methylarsonic acid (EXP) mono(2-ethylhexyl) phthalate (ISO) N-acetyl-L-cysteine (ISO) N-ethyl-N-(2-hydroxyethyl)nitrosamine (EXP) N-ethyl-N-nitrosourea (EXP) N-methyl-N-nitrosourea (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) nefazodone (ISO) nickel dichloride (EXP) nitrofen (EXP) ochratoxin A (EXP) oleamide (ISO) omeprazole (EXP) paracetamol (EXP,ISO) paraquat (EXP,ISO) pentachlorophenol (ISO) pentobarbital (EXP) perfluorononanoic acid (ISO) perfluorooctanoic acid (EXP) phenanthrene (EXP) phenethyl caffeate (EXP) phenobarbital (EXP,ISO) pirinixic acid (EXP,ISO) prednisolone (ISO) propanal (ISO) pyrene (EXP) quercetin (ISO) SB 203580 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) tacrolimus hydrate (ISO) tamoxifen (EXP) tetrachloromethane (EXP,ISO) tetraphene (ISO) Theaflavin 3,3'-digallate (ISO) thioacetamide (EXP) titanium dioxide (ISO) trimethylarsine oxide (EXP) urethane (ISO) valproic acid (ISO) vancomycin (ISO) zearalenone (ISO) zoledronic acid (ISO)
1.
Connexin32 can restore hearing in connexin26 deficient mice.
Degen J, etal., Eur J Cell Biol. 2011 Oct;90(10):817-24. doi: 10.1016/j.ejcb.2011.05.001. Epub 2011 Aug 2.
2.
Expression of multiple connexins in the rat epididymis indicates a complex regulation of gap junctional communication.
Dufresne J, etal., Am J Physiol Cell Physiol 2003 Jan;284(1):C33-43.
3.
Altered expression and function of hepatocyte gap junctions after common bile duct ligation in the rat.
Fallon MB, etal., Am J Physiol. 1995 May;268(5 Pt 1):C1186-94.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Gap junctions between cells expressing connexin 43 or 32 show inverse permselectivity to adenosine and ATP.
Goldberg GS, etal., J Biol Chem 2002 Sep 27;277(39):36725-30.
7.
Reduced cell-cell communication in experimentally induced autoimmune thyroid disease.
Green LM, etal., Endocrinology. 1996 Jul;137(7):2823-32.
8.
Defining a minimal motif required to prevent connexin oligomerization in the endoplasmic reticulum.
Maza J, etal., J Biol Chem. 2005 Jun 3;280(22):21115-21. Epub 2005 Apr 7.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Structure of a gap junction gene: rat connexin-32.
Miller T, etal., Biosci Rep 1988 Oct;8(5):455-64.
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
13.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
14.
Molecular cloning of cDNA for rat liver gap junction protein.
Paul DL J Cell Biol 1986 Jul;103(1):123-34.
15.
Identification of cells expressing Cx43, Cx30, Cx26, Cx32 and Cx36 in gap junctions of rat brain and spinal cord.
Rash JE, etal., Cell Commun Adhes 2001;8(4-6):315-20.
16.
GOA pipeline
RGD automated data pipeline
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Differential changes in expression of gap junction proteins connexin 26 and 32 during hepatocarcinogenesis in rats.
Sakamoto H, etal., Jpn J Cancer Res. 1992 Nov;83(11):1210-5.
20.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
21.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Gjb1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 70,541,845 - 70,549,776 (+) NCBI GRCr8 mRatBN7.2 X 66,501,848 - 66,509,783 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 66,501,820 - 66,509,925 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 67,985,201 - 67,993,132 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 71,485,591 - 71,493,522 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 69,046,498 - 69,054,429 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 71,272,030 - 71,279,973 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 71,272,042 - 71,279,977 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 72,123,958 - 72,131,901 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 89,448,873 - 89,456,812 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 89,522,360 - 89,530,242 (+) NCBI Celera X 66,857,755 - 66,865,686 (+) NCBI Celera Cytogenetic Map X q22 NCBI
GJB1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 71,215,239 - 71,225,516 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 71,212,811 - 71,225,516 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 70,435,089 - 70,445,366 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 70,351,787 - 70,361,777 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 70,226,096 - 70,228,065 NCBI Celera X 70,788,947 - 70,798,946 (+) NCBI Celera Cytogenetic Map X q13.1 NCBI HuRef X 64,252,835 - 64,262,404 (+) NCBI HuRef CHM1_1 X 70,328,093 - 70,338,111 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 69,649,327 - 69,659,597 (+) NCBI T2T-CHM13v2.0
Gjb1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 100,419,982 - 100,429,235 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 100,419,984 - 100,429,235 (+) Ensembl GRCm39 Ensembl GRCm38 X 101,376,376 - 101,385,629 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 101,376,378 - 101,385,629 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 98,572,676 - 98,580,964 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 97,580,056 - 97,588,344 (+) NCBI MGSCv36 mm8 Celera X 88,294,129 - 88,302,410 (+) NCBI Celera Cytogenetic Map X D NCBI cM Map X 44.06 NCBI
Gjb1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955475 10,785,996 - 10,787,910 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955475 10,779,415 - 10,787,910 (+) NCBI ChiLan1.0 ChiLan1.0
GJB1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 70,899,720 - 70,901,737 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 70,903,323 - 70,905,340 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 60,490,579 - 60,492,606 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 70,538,213 - 70,548,917 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 70,547,110 - 70,547,961 (+) Ensembl panpan1.1 panPan2
GJB1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 55,565,995 - 55,575,332 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 55,573,808 - 55,574,659 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 46,392,855 - 46,402,183 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 56,534,870 - 56,544,201 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 56,542,150 - 56,544,198 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 54,502,814 - 54,512,141 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 55,834,274 - 55,843,612 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 55,761,402 - 55,770,733 (+) NCBI UU_Cfam_GSD_1.0
Gjb1
GJB1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 57,242,045 - 57,249,885 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 57,241,990 - 57,249,496 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 64,844,639 - 64,852,103 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GJB1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 61,013,991 - 61,019,222 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 61,017,716 - 61,018,567 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666065 2,883,820 - 2,885,847 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gjb1
.
Predicted Target Of
Count of predictions: 174 Count of miRNA genes: 135 Interacting mature miRNAs: 151 Transcripts: ENSRNOT00000004979 Prediction methods: Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 61431 Cia19 Collagen induced arthritis QTL 19 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 65612192 120568734 Rat 738035 Stresp1 Stress response QTL 1 4.96 0.000011 stress-related behavior trait (VT:0010451) defensive burying - coping X 41304447 112935181 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
21
99
91
90
59
19
59
6
182
61
79
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000076034 ⟹ ENSRNOP00000068485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 66,501,860 - 66,508,609 (+) Ensembl Rnor_6.0 Ensembl X 71,272,042 - 71,278,791 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076816 ⟹ ENSRNOP00000068248
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 71,272,045 - 71,279,977 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095443 ⟹ ENSRNOP00000083358
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 66,501,820 - 66,509,925 (+) Ensembl
RefSeq Acc Id:
NM_017251 ⟹ NP_058947
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 70,541,845 - 70,549,776 (+) NCBI mRatBN7.2 X 66,501,848 - 66,509,779 (+) NCBI Rnor_6.0 X 71,272,030 - 71,279,969 (+) NCBI Rnor_5.0 X 72,123,958 - 72,131,901 (+) NCBI RGSC_v3.4 X 89,448,873 - 89,456,812 (+) RGD Celera X 66,857,755 - 66,865,686 (+) RGD
Sequence:
CAGACAGACACGCCTGCATACATTCCCTGGGAAAAAGCAGTTGCAACCAGGTGTGGCAGTGCCAGGGAGGTGTGAATGAGGCAGGATGAACTGGACAGGTCTATACACCTTGCTCAGTGGCGTGAATC
hide sequence
RefSeq Acc Id:
XM_008773255 ⟹ XP_008771477
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 70,542,370 - 70,549,776 (+) NCBI mRatBN7.2 X 66,502,799 - 66,509,783 (+) NCBI Rnor_6.0 X 71,273,845 - 71,279,973 (+) NCBI
Sequence:
TTAGTTTGTTTTTGAGCAGGATATTATATAGCCCAGTGTGGCCTCAAACTTACTATGTAGCTGA
hide sequence
RefSeq Acc Id:
XM_017601945 ⟹ XP_017457434
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 70,541,865 - 70,549,776 (+) NCBI mRatBN7.2 X 66,501,902 - 66,509,783 (+) NCBI Rnor_6.0 X 71,278,037 - 71,279,973 (+) NCBI
Sequence:
CACCGGGAGGCGATGAATTGGGACGCAGGCGCGACCACAGGGACCACTCCCCCTACACAGACAT
hide sequence
RefSeq Acc Id:
NP_058947 ⟸ NM_017251
- UniProtKB:
P08033 (UniProtKB/Swiss-Prot), A0A654IET2 (UniProtKB/TrEMBL)
- Sequence:
MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHIS
hide sequence
RefSeq Acc Id:
XP_008771477 ⟸ XM_008773255
- Peptide Label:
isoform X1
- UniProtKB:
P08033 (UniProtKB/Swiss-Prot), A0A654IET2 (UniProtKB/TrEMBL)
- Sequence:
MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVC
hide sequence
RefSeq Acc Id:
XP_017457434 ⟸ XM_017601945
- Peptide Label:
isoform X1
- UniProtKB:
P08033 (UniProtKB/Swiss-Prot), A0A654IET2 (UniProtKB/TrEMBL)
- Sequence:
MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHIS
hide sequence
Ensembl Acc Id:
ENSRNOP00000068248 ⟸ ENSRNOT00000076816
Ensembl Acc Id:
ENSRNOP00000068485 ⟸ ENSRNOT00000076034
Ensembl Acc Id:
ENSRNOP00000083358 ⟸ ENSRNOT00000095443
RGD ID: 13701876 Promoter ID: EPDNEW_R12400 Type: initiation region Name: Gjb1_1 Description: gap junction protein, beta 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 71,272,051 - 71,272,111 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-05-20
Gjb1
gap junction protein, beta 1
Gjb1
gap junction membrane channel protein beta 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Gjb1
gap junction membrane channel protein beta 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in adult epididymis; present between apical cells and principal cells, between narrow cells and principal cells and between clear and principal cells
628541
gene_physical_interaction
interacts with other subunits as homomers and heteromers to form gap junction
628541
gene_process
may play a role in epididymal development
628541
gene_regulation
expression is low throughout the epididymis in young animals and begins to increase in the second and third weeks postnatally
628541
