Atg4d (autophagy related 4D, cysteine peptidase) - Rat Genome Database

Atg4d (autophagy related 4D, cysteine peptidase) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Atg4d (autophagy related 4D, cysteine peptidase) Rattus norvegicus

Subscribe to Updates

Symbol:

Atg4d

Name:

autophagy related 4D, cysteine peptidase

RGD ID:

1596392

Description:

Predicted to enable cysteine-type endopeptidase activity; cysteine-type exopeptidase activity; and protein-phosphatidylethanolamide deconjugating activity. Predicted to be involved in macroautophagy; protein delipidation; and protein processing. Predicted to be located in mitochondrion and nucleoplasm. Predicted to be active in cytoplasm. Orthologous to human ATG4D (autophagy related 4D cysteine peptidase); PARTICIPATES IN autophagy pathway; INTERACTS WITH 17beta-estradiol; 4,4'-sulfonyldiphenol; bisphenol A.

Type:

protein-coding

RefSeq Status:

Previously known as:

ATG4 autophagy related 4 homolog D; ATG4 autophagy related 4 homolog D (S. cerevisiae); autophagy-related 4D; autophagy-related 4D (S. cerevisiae); cysteine protease ATG4D; LOC686505; similar to APG4-D protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	28,083,902 - 28,093,491 (+)	NCBI		GRCr8
mRatBN7.2	8	19,807,733 - 19,817,321 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	19,807,766 - 19,817,321 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	23,827,592 - 23,837,142 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	22,125,441 - 22,134,991 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	20,037,455 - 20,047,010 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	22,291,445 - 22,301,331 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	22,291,445 - 22,301,331 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,344,081 - 22,353,967 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	8	21,199,310 - 21,208,865 (+)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg4d	Rat	Liver Reperfusion Injury	ameliorates	ISO	Atg4d (Mus musculus)	329902072		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg4d	Rat	familial hypercholesterolemia		ISO	ATG4D (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial hypercholesterolemia	ClinVar	PMID:20809525 more ...
Atg4d	Rat	immunodeficiency 35		ISO	ATG4D (Homo sapiens)	8554872	ClinVar Annotator: match by term: Immunodeficiency 35	ClinVar	PMID:28492532
Atg4d	Rat	Neurodevelopmental Disorders		ISO	ATG4D (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg4d	Rat	cerebellar ataxia		ISO	ATG4D (Canis lupus familiaris)	9068941	Neurodegenerative vacuolar storage disease	OMIA	PMID:25875846 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg4d	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	ATG4D (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of ATG4D mRNA	CTD	PMID:22079256
Atg4d	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Atg4d (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of ATG4D mRNA]	CTD	PMID:22206623
Atg4d	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Atg4d (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of ATG4D mRNA	CTD	PMID:22206623
Atg4d	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of ATG4D mRNA	CTD	PMID:32145629
Atg4d	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Atg4d (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of ATG4D mRNA	CTD	PMID:24680724
Atg4d	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Atg4d (Mus musculus)	6480464	bisphenol S results in decreased expression of ATG4D mRNA	CTD	PMID:39298647
Atg4d	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ATG4D mRNA	CTD	PMID:36041667
Atg4d	Rat	aflatoxin B1	increases methylation	ISO	ATG4D (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of ATG4D polyA tail	CTD	PMID:30157460
Atg4d	Rat	all-trans-retinoic acid	multiple interactions	ISO	ATG4D (Homo sapiens)	6480464	SPI1 protein affects the reaction [Tretinoin results in increased expression of ATG4D mRNA]	CTD	PMID:29743969
Atg4d	Rat	all-trans-retinoic acid	increases expression	ISO	ATG4D (Homo sapiens)	6480464	Tretinoin results in increased expression of ATG4D mRNA	CTD	PMID:29743969
Atg4d	Rat	aristolochic acid A	increases expression	ISO	ATG4D (Homo sapiens)	6480464	aristolochic acid I results in increased expression of ATG4D mRNA	CTD	PMID:33212167
Atg4d	Rat	arsenite(3-)	increases expression	ISO	ATG4D (Homo sapiens)	6480464	arsenite results in increased expression of ATG4D mRNA and arsenite results in increased expression of ATG4D protein	CTD	PMID:34929507
Atg4d	Rat	benzo[a]pyrene	decreases expression	ISO	Atg4d (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of ATG4D mRNA	CTD	PMID:22228805
Atg4d	Rat	benzo[a]pyrene	affects methylation	ISO	ATG4D (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of ATG4D polyA tail	CTD	PMID:30157460
Atg4d	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ATG4D mRNA	CTD	PMID:25181051 and PMID:32145629
Atg4d	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ATG4D mRNA	CTD	PMID:36041667
Atg4d	Rat	bisphenol A	increases expression	ISO	Atg4d (Mus musculus)	6480464	bisphenol A results in increased expression of ATG4D mRNA	CTD	PMID:32156529 and PMID:33221593
Atg4d	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ATG4D mRNA	CTD	PMID:30816183
Atg4d	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of ATG4D gene	CTD	PMID:28505145
Atg4d	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ATG4D mRNA	CTD	PMID:36041667
Atg4d	Rat	chlorpyrifos	increases expression	ISO	Atg4d (Mus musculus)	6480464	Chlorpyrifos results in increased expression of ATG4D mRNA	CTD	PMID:37019170
Atg4d	Rat	epoxiconazole	decreases expression	ISO	Atg4d (Mus musculus)	6480464	epoxiconazole results in decreased expression of ATG4D mRNA	CTD	PMID:35436446
Atg4d	Rat	ethyl methanesulfonate	increases expression	ISO	ATG4D (Homo sapiens)	6480464	Ethyl Methanesulfonate results in increased expression of ATG4D mRNA	CTD	PMID:23649840
Atg4d	Rat	folic acid	multiple interactions	ISO	Atg4d (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of ATG4D mRNA]	CTD	PMID:22206623
Atg4d	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of ATG4D mRNA	CTD	PMID:33387578
Atg4d	Rat	methotrexate	increases expression	ISO	ATG4D (Homo sapiens)	6480464	Methotrexate results in increased expression of ATG4D mRNA	CTD	PMID:21678067
Atg4d	Rat	methyl methanesulfonate	increases expression	ISO	ATG4D (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of ATG4D mRNA	CTD	PMID:23649840
Atg4d	Rat	nitrates	multiple interactions	ISO	Atg4d (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ATG4D mRNA	CTD	PMID:35964746
Atg4d	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of ATG4D mRNA	CTD	PMID:25729387
Atg4d	Rat	oxaliplatin	decreases expression	EXP		6480464	oxaliplatin results in decreased expression of ATG4D mRNA	CTD	PMID:25729387
Atg4d	Rat	paracetamol	affects expression	ISO	Atg4d (Mus musculus)	6480464	Acetaminophen affects the expression of ATG4D mRNA	CTD	PMID:17562736
Atg4d	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	Atg4d (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of ATG4D mRNA	CTD	PMID:37995155
Atg4d	Rat	potassium chromate	multiple interactions	ISO	ATG4D (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of ATG4D mRNA	CTD	PMID:22079256
Atg4d	Rat	potassium chromate	increases expression	ISO	ATG4D (Homo sapiens)	6480464	potassium chromate(VI) results in increased expression of ATG4D mRNA	CTD	PMID:22079256
Atg4d	Rat	silver atom	increases expression	ISO	Atg4d (Mus musculus)	6480464	Silver results in increased expression of ATG4D mRNA	CTD	PMID:27131904
Atg4d	Rat	silver(0)	increases expression	ISO	Atg4d (Mus musculus)	6480464	Silver results in increased expression of ATG4D mRNA	CTD	PMID:27131904
Atg4d	Rat	sodium arsenite	increases expression	ISO	ATG4D (Homo sapiens)	6480464	sodium arsenite results in increased expression of ATG4D mRNA	CTD	PMID:38568856
Atg4d	Rat	testosterone	increases expression	ISO	ATG4D (Homo sapiens)	6480464	Testosterone results in increased expression of ATG4D mRNA	CTD	PMID:33359661
Atg4d	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of ATG4D mRNA	CTD	PMID:34492290
Atg4d	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of ATG4D mRNA	CTD	PMID:25729387
Atg4d	Rat	topotecan	decreases expression	EXP		6480464	Topotecan results in decreased expression of ATG4D mRNA	CTD	PMID:25729387
Atg4d	Rat	triphenyl phosphate	affects expression	ISO	ATG4D (Homo sapiens)	6480464	triphenyl phosphate affects the expression of ATG4D mRNA	CTD	PMID:37042841
Atg4d	Rat	valdecoxib	increases expression	EXP		6480464	valdecoxib results in increased expression of ATG4D mRNA	CTD	PMID:24136188

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg4d	Rat	aggrephagy	involved_in	IBA	PANTHER:PTN002503342 and WB:WBGene00013595	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg4d	Rat	autophagosome assembly	involved_in	ISO	ATG4D (Homo sapiens) and UniProtKB:Q86TL0-2	1624291	PMID:21177865	RGD	PMID:21177865
Atg4d	Rat	autophagosome assembly	involved_in	IBA	MGI:1913865 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg4d	Rat	autophagy	involved_in	ISO	ATG4D (Homo sapiens)	1624291	PMID:30661429	RGD	PMID:30661429
Atg4d	Rat	autophagy	involved_in	IEA	UniProtKB:Q86TL0 and ensembl:ENSP00000311318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg4d	Rat	autophagy	involved_in	IEA	UniProtKB-KW:KW-0072	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Atg4d	Rat	biological_process		ND		1598407	12/10: no relevant rat data	RGD
Atg4d	Rat	mitophagy	involved_in	ISO	ATG4D (Homo sapiens)	1624291	PMID:33773106	RGD	PMID:33773106
Atg4d	Rat	mitophagy	involved_in	IEA	UniProtKB:Q86TL0 and ensembl:ENSP00000311318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg4d	Rat	mitophagy	involved_in	IBA	PANTHER:PTN002503342 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg4d	Rat	piecemeal microautophagy of the nucleus	involved_in	IBA	PANTHER:PTN002503342 and SGD:S000005167	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg4d	Rat	protein delipidation	involved_in	ISO	ATG4D (Homo sapiens)	1624291	PMID:29458288	RGD	PMID:29458288
Atg4d	Rat	protein delipidation	involved_in	ISO	Atg4d (Mus musculus)	1624291	PMID:33795848	RGD	PMID:33795848
Atg4d	Rat	protein localization to phagophore assembly site	involved_in	ISO	ATG4D (Homo sapiens)	1624291	PMID:33773106	RGD	PMID:33773106
Atg4d	Rat	protein localization to phagophore assembly site	involved_in	IEA	UniProtKB:Q86TL0 and ensembl:ENSP00000311318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg4d	Rat	protein processing	involved_in	IBA	PANTHER:PTN002503342 and WB:WBGene00013595	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg4d	Rat	protein transport	involved_in	IEA	UniProtKB-KW:KW-0653	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Atg4d	Rat	proteolysis	involved_in	ISO	ATG4D (Homo sapiens)	1624291	PMID:21177865	RGD	PMID:21177865
Atg4d	Rat	proteolysis	involved_in	IEA	UniProtKB:Q86TL0 and ensembl:ENSP00000311318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg4d	Rat	proteolysis	involved_in	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg4d	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Atg4d	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Atg4d	Rat	cytoplasm	is_active_in	IBA	MGI:1913865 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg4d	Rat	mitochondrion	located_in	ISO	ATG4D (Homo sapiens) and UniProtKB:Q86TL0-1	1624291		RGD	GO_REF:0000052
Atg4d	Rat	mitochondrion	located_in	IEA	UniProtKB:Q86TL0 and ensembl:ENSP00000311318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg4d	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q86TL0 and ensembl:ENSP00000311318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg4d	Rat	nucleoplasm	located_in	ISO	ATG4D (Homo sapiens) and UniProtKB:Q86TL0-1	1624291		RGD	GO_REF:0000052

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg4d	Rat	cysteine-type endopeptidase activity	enables	IBA	PANTHER:PTN002503342 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg4d	Rat	cysteine-type exopeptidase activity	enables	ISO	ATG4D (Homo sapiens) and UniProtKB:Q86TL0-2	1624291	PMID:21177865	RGD	PMID:21177865
Atg4d	Rat	cysteine-type peptidase activity	enables	ISO	ATG4D (Homo sapiens)	1624291	PMID:21177865 and PMID:30661429	RGD	PMID:21177865 and PMID:30661429
Atg4d	Rat	cysteine-type peptidase activity	enables	IEA	UniProtKB:Q86TL0 and ensembl:ENSP00000311318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg4d	Rat	cysteine-type peptidase activity	enables	IEA	InterPro:IPR005078 and InterPro:IPR046792	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Atg4d	Rat	cysteine-type peptidase activity	enables	IEA	UniProtKB-KW:KW-0788	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Atg4d	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Atg4d	Rat	peptidase activity	enables	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Atg4d	Rat	protein-phosphatidylethanolamide deconjugating activity	enables	IEA	InterPro:IPR046792	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Atg4d	Rat	protein-phosphatidylethanolamide deconjugating activity	enables	IBA	PANTHER:PTN002503342 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg4d	Rat	autophagy pathway		ISO	ATG4D (Homo sapiens)	1643329		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg4d	Rat	autophagy pathway		IEA		6907045		KEGG	rno:04140

#	Reference Title	Reference Citation
1.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Comprehensive gene review and curation	RGD comprehensive gene curation
4.	Hepatic interferon regulatory factor 8 expression mediates liver ischemia/reperfusion injury in mice.	Shi G, etal., Biochem Pharmacol. 2021 Oct;192:114728. doi: 10.1016/j.bcp.2021.114728. Epub 2021 Aug 13.
5.	LC3 conjugation system in mammalian autophagy.	Tanida I, etal., Int J Biochem Cell Biol. 2004 Dec;36(12):2503-18.

PMID:8889548	PMID:12477932	PMID:21177865

Atg4d
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	28,083,902 - 28,093,491 (+)	NCBI		GRCr8
mRatBN7.2	8	19,807,733 - 19,817,321 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	19,807,766 - 19,817,321 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	23,827,592 - 23,837,142 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	22,125,441 - 22,134,991 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	20,037,455 - 20,047,010 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	22,291,445 - 22,301,331 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	22,291,445 - 22,301,331 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,344,081 - 22,353,967 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	8	21,199,310 - 21,208,865 (+)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

ATG4D
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	10,543,904 - 10,553,418 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	10,543,895 - 10,553,418 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	10,654,580 - 10,664,094 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	10,515,647 - 10,525,094 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	10,515,646 - 10,525,093	NCBI
Celera	19	10,549,363 - 10,558,810 (+)	NCBI		Celera
Cytogenetic Map	19	p13.2	NCBI
HuRef	19	10,232,683 - 10,242,060 (+)	NCBI		HuRef
CHM1_1	19	10,655,287 - 10,664,815 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	10,664,918 - 10,679,876 (+)	NCBI		T2T-CHM13v2.0

Atg4d
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	21,176,496 - 21,186,133 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	21,176,589 - 21,189,068 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	21,265,205 - 21,274,837 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	21,265,293 - 21,277,772 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	21,069,743 - 21,078,812 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	21,015,701 - 21,024,770 (+)	NCBI		MGSCv36	mm8
Celera	9	18,534,424 - 18,543,493 (+)	NCBI		Celera
Cytogenetic Map	9	A3	NCBI
cM Map	9	7.75	NCBI

Atg4d
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	1,739,982 - 1,746,362 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	1,739,982 - 1,746,362 (+)	NCBI	ChiLan1.0	ChiLan1.0

ATG4D
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	15,462,360 - 15,471,847 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	14,460,973 - 14,470,447 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	10,095,768 - 10,105,250 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	10,758,544 - 10,767,712 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	10,758,544 - 10,767,712 (+)	Ensembl	panpan1.1		panPan2

ATG4D
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	50,618,458 - 50,623,703 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	50,618,459 - 50,624,179 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	50,490,720 - 50,495,909 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	51,141,597 - 51,146,788 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	51,141,586 - 51,146,773 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	50,348,430 - 50,353,618 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	50,776,503 - 50,781,692 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	51,017,552 - 51,022,743 (-)	NCBI		UU_Cfam_GSD_1.0

Atg4d
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	209,513,140 - 209,531,379 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	823,172 - 830,521 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	823,318 - 830,642 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATG4D
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	69,320,331 - 69,328,519 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	69,320,313 - 69,328,522 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	69,706,013 - 69,714,211 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATG4D
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	9,555,792 - 9,565,295 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	9,555,780 - 9,568,814 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	10,424,399 - 10,434,629 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atg4d
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	2,617,773 - 2,624,756 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	2,617,853 - 2,624,756 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Atg4d
44 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	54
Count of miRNA genes:	52
Interacting mature miRNAs:	52
Transcripts:	ENSRNOT00000075174
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
9590084	Insglur5	Insulin/glucose ratio QTL 5	18.54	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	8	1	24597739	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
2317882	Alcrsp24	Alcohol response QTL 24	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	8	1	25902202	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat

RH136985

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	19,817,106 - 19,817,287 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	22,301,117 - 22,301,297	NCBI	Rnor6.0
Rnor_5.0	8	22,353,753 - 22,353,933	UniSTS	Rnor5.0
Celera	8	21,208,651 - 21,208,831	UniSTS
RH 3.4 Map	8	180.05	UniSTS

RH140242

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	19,809,947 - 19,810,155 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	22,293,627 - 22,293,834	NCBI	Rnor6.0
Rnor_5.0	8	22,346,263 - 22,346,470	UniSTS	Rnor5.0
Celera	8	21,201,492 - 21,201,699	UniSTS
RH 3.4 Map	8	182.7	UniSTS

AI228232

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	19,817,106 - 19,817,309 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	22,301,117 - 22,301,319	NCBI	Rnor6.0
Rnor_5.0	8	22,353,753 - 22,353,955	UniSTS	Rnor5.0
Celera	8	21,208,651 - 21,208,853	UniSTS
RH 3.4 Map	8	205.59	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001101013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005487922	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005487923	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC107650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168141	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BG371460	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DY318309	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000075174 ⟹ ENSRNOP00000064764

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	19,807,766 - 19,817,321 (+)	Ensembl
Rnor_6.0 Ensembl	8	22,291,445 - 22,301,331 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000083194 ⟹ ENSRNOP00000068960

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	19,809,174 - 19,817,321 (+)	Ensembl
Rnor_6.0 Ensembl	8	22,291,463 - 22,301,325 (+)	Ensembl

RefSeq Acc Id:

NM_001101013 ⟹ NP_001094483

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,083,936 - 28,093,491 (+)	NCBI
mRatBN7.2	8	19,807,766 - 19,817,321 (+)	NCBI
Rnor_6.0	8	22,291,445 - 22,301,331 (+)	NCBI
Rnor_5.0	8	22,344,081 - 22,353,967 (+)	NCBI
Celera	8	21,199,310 - 21,208,865 (+)	RGD

Sequence:

show sequence

CCGGGTGCTTTGGGCCACCAAGATGGCGCTGGCTGTGGTAACCCGGGTACCCGCTGCGGCTAGAGCCGGACCCGGGAGCCCAGCTCTGGGTATAGAGTAGTGCTCTTCTGGCTGCGGGGCTGCCCCTG
AGCGTTCGCAGTTCCCCGGACCTCGGGGACACCTGCGTCCTTCCTCCCCGGCGCGTCCATGAACTCCGTGTCGCCGGCTGCGGCGCAGTACCGCAGCGGGAGCCCGGAGGACGCGCGCCGGCCCGATT
GTCGCCGGCCGAGGGGACAAACCCGGATCCCGGATCCCAGCAACCTTGGACCTTCGGGGTCTGGCGTGGCAGCTCTCGGCTCAACTGGAACTGACCCCGCCGAGCCTGACGAGGTGGACAAGTTCAAA
ACCAAGTTCCTGACAGCTTGGAACAACGTCAAGTATGGTTGGGCAGTTAAAAGCCGGACCAGCTTCAGCAAGATCTCCAGTGTTCATCTCTGCGGGCGATGCTACCATTTCGAGGGAGAGGGTGACAT
CCAGCGGTTTCAAAGGGACTTTGTATCTCGACTATGGCTTACATATCGCCGGGACTTCCCACCCCTAGCTGGGAGCCTGACCTCAGACTGTGGCTGGGGATGTATGTTACGAAGTGGTCAGATGATGC
TGGCCCAGGGCCTGCTCCTGCATTTTCTGCCTAGAGACTGGAGGTGGGTGGAGGGCACAGGATTGGCCTCCTCTGAGATGCCAGGGCCAGCCTCTCCCAGTCGATACCGAGGGCCTGGTCGCCGTGGT
CCTCTGCGATGCGCCCAGGGTGCACTGGAGATGGAACCGGATCGCTGGCACCGGCGGATTGTTTCCTGGTTTGCTGATCATCCTCAGGCCCCCTTCGGTCTACATCGCCTAGTGGAACTTGGGCAGAG
CTCTGGCAAGAAGGCAGGAGACTGGTATGGACCCTCTGTGGTGGCACACATCCTCAGGAAAGCAGTGGAGAGCTGCTCAGAAGTCACCCGCCTGGTGGTGTACGTCTCTCAGGACTGCACAGTGTACA
AGGCAGATGTGGCACGCCTGGTGTCCTGGCCAGATCCCACAGCTGAGTGGAAGTCTGTTGTCATCCTGGTGCCTGTACGACTGGGTGGGGAGACTCTTAACCCTGTGTATGTGCCCTGTGTGAAGGAG
CTTCTGCGCTCAGAACTCTGCCTGGGCATTATGGGGGGCAAACCTCGACATTCACTGTACTTCATTGGCTATCAGGATGACTTTCTGCTCTACCTGGATCCCCACTACTGCCAGCCCACAGTGGATGT
CAACCAGGCCAACTTCCCACTGGAGTCCTTTCACTGCACCTCGCCCCGCAAGATGGCCTTTGCCAAGATGGACCCCAGCTGTACCGTGGGGTTCTATGCTGGGAACAGGAAGGAGTTTGAGACCCTCT
GCTCGGAGCTGATGAGGATCCTCAGCTCCTCCTCAGTCACGGAACGTTACCCCATGTTCACAGTGGCTGAGGGCCATGCTCAGGACCACAGCCTGGATGCCCTCTGCACCCAGCTCTCCCAGCCCACA
CTGCGACTACCTTGCACAGGACGCCTACTCAAGGCCAAAAGGCCCAGCTCTGAGGACTTTGTGTTTTTATAATGGGAAGGGATGGGAAAGATGCCAGACTATTTATTTTTTTATTTATGTCATGTCAG
GTATGGGATCTGGAACTCCAGAGGTGGTGCTGGACCCCTGTCCTCATGTCCCCGATCCTCCCCAACACAGCTGAGACCTATCTAGGCCCCCAGCTTGGGGTTGTGCCCTTTCGAGTCCTCACCCCCAG
CTGCCCCTGACTCCTCAGGAGCCGGGGATGGAGTGGGCTCCGGGGCACTCACTCAGGGCCTGATTCAAGTTCTGTAGCCTGCGCTGGATGACTGGGAGGACTGACTGACTGTCAGTGGAGGCTGATAA
ACATGCAGACTTGAGTGTGAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039082159 ⟹ XP_038938087

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,085,555 - 28,093,486 (+)	NCBI
mRatBN7.2	8	19,809,387 - 19,817,321 (+)	NCBI

RefSeq Acc Id:

XR_005487922

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,083,902 - 28,092,302 (+)	NCBI
mRatBN7.2	8	19,807,733 - 19,816,132 (+)	NCBI

RefSeq Acc Id:

XR_005487923

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,083,902 - 28,092,302 (+)	NCBI
mRatBN7.2	8	19,807,733 - 19,816,132 (+)	NCBI


Protein RefSeqs	NP_001094483	(Get FASTA)	NCBI Sequence Viewer
	XP_038938087	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI07651	(Get FASTA)	NCBI Sequence Viewer
	AAI68141	(Get FASTA)	NCBI Sequence Viewer
	EDL78309	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064764
	ENSRNOP00000064764.1
	ENSRNOP00000068960.2

RefSeq Acc Id:

NP_001094483 ⟸ NM_001101013

- UniProtKB:

B4F756 (UniProtKB/TrEMBL), M0R5T6 (UniProtKB/TrEMBL), A6JNQ6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNSVSPAAAQYRSGSPEDARRPDCRRPRGQTRIPDPSNLGPSGSGVAALGSTGTDPAEPDEVDKFKTKFLTAWNNVKYGWAVKSRTSFSKISSVHLCGRCYHFEGEGDIQRFQRDFVSRLWLTYRRDF
PPLAGSLTSDCGWGCMLRSGQMMLAQGLLLHFLPRDWRWVEGTGLASSEMPGPASPSRYRGPGRRGPLRCAQGALEMEPDRWHRRIVSWFADHPQAPFGLHRLVELGQSSGKKAGDWYGPSVVAHILR
KAVESCSEVTRLVVYVSQDCTVYKADVARLVSWPDPTAEWKSVVILVPVRLGGETLNPVYVPCVKELLRSELCLGIMGGKPRHSLYFIGYQDDFLLYLDPHYCQPTVDVNQANFPLESFHCTSPRKMA
FAKMDPSCTVGFYAGNRKEFETLCSELMRILSSSSVTERYPMFTVAEGHAQDHSLDALCTQLSQPTLRLPCTGRLLKAKRPSSEDFVFL

hide sequence

Ensembl Acc Id:

ENSRNOP00000064764 ⟸ ENSRNOT00000075174

Ensembl Acc Id:

ENSRNOP00000068960 ⟸ ENSRNOT00000083194

RefSeq Acc Id:	XP_038938087 ⟸ XM_039082159
- Peptide Label:	isoform X1
- UniProtKB:	A6JNQ8 (UniProtKB/TrEMBL)

Protein Domains

Peptidase C54 catalytic

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R5T6-F1-model_v2	AlphaFold	M0R5T6	1-473	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

Promoter ID:

Type:

multiple initiation site

Name:

Atg4d_1

Description:

autophagy related 4D, cysteine peptidase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	22,291,456 - 22,291,516	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-31430	BioCyc
Ensembl Genes	ENSRNOG00000047625	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000075174	ENTREZGENE
	ENSRNOT00000075174.3	UniProtKB/TrEMBL
	ENSRNOT00000083194.2	UniProtKB/TrEMBL
InterPro	Papain_like_cys_pep_sf	UniProtKB/TrEMBL
	Peptidase_C54	UniProtKB/TrEMBL
	Peptidase_C54_cat	UniProtKB/TrEMBL
KEGG Report	rno:686505	UniProtKB/TrEMBL
NCBI Gene	686505	ENTREZGENE
PANTHER	CYSTEINE PROTEASE ATG4D	UniProtKB/TrEMBL
	PTHR22624	UniProtKB/TrEMBL
Pfam	Peptidase_C54	UniProtKB/TrEMBL
PhenoGen	Atg4d	PhenoGen
RatGTEx	ENSRNOG00000047625	RatGTEx
Superfamily-SCOP	SSF54001	UniProtKB/TrEMBL
UniProt	A0A0G2JU44_RAT	UniProtKB/TrEMBL
	A6JNQ6	ENTREZGENE, UniProtKB/TrEMBL
	A6JNQ8	ENTREZGENE, UniProtKB/TrEMBL
	B4F756	ENTREZGENE, UniProtKB/TrEMBL
	M0R5T6	ENTREZGENE, UniProtKB/TrEMBL
	Q3B7D7_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-06-07	Atg4d	autophagy related 4D, cysteine peptidase	Atg4d	ATG4 autophagy related 4 homolog D (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-03	Atg4d	autophagy-related 4D (S. cerevisiae)	LOC686505	similar to APG4-D protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-03	Atg4d	ATG4 autophagy related 4 homolog D (S. cerevisiae)	Atg4d	autophagy-related 4D (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC686505	similar to APG4-D protein			Symbol and Name status set to provisional	70820	PROVISIONAL