Advanced Search (OLGA)

Gene: Lingo3 (leucine rich repeat and Ig domain containing 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Lingo3

Name:

leucine rich repeat and Ig domain containing 3

RGD ID:

1592209

Description:

Predicted to be active in extracellular matrix and extracellular space. Orthologous to human LINGO3 (leucine rich repeat and Ig domain containing 3); INTERACTS WITH 6-propyl-2-thiouracil; amphetamine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3; LOC686868; LOC690755; similar to leucine rich repeat neuronal 6C

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,519,252 - 9,530,675 (+)	NCBI		GRCr8
mRatBN7.2	7	8,869,025 - 8,878,431 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,869,025 - 8,878,431 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	11,753,044 - 11,762,461 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,628,548 - 13,637,965 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,495,081 - 11,504,496 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,737,293 - 11,746,703 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,737,293 - 11,746,703 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	11,905,008 - 11,914,418 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	10,379,660 - 10,389,070 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	7,053,134 - 7,062,544 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lingo3	Rat	myoepithelioma		ISO	LINGO3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Myoepithelial tumor	ClinVar
Lingo3	Rat	Neurodevelopmental Disorders		ISO	LINGO3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Lingo3	Rat	progressive myoclonus epilepsy 9		ISO	LINGO3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Progressive myoclonic epilepsy type 9	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lingo3	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	Lingo3 (Mus musculus)	6480464	tetrabromobisphenol A results in decreased expression of LINGO3 mRNA	CTD	PMID:25172293
Lingo3	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	Lingo3 (Mus musculus)	6480464	bisphenol S results in increased methylation of LINGO3 exon	CTD	PMID:33297965
Lingo3	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Lingo3 (Mus musculus)	6480464	bisphenol S affects the methylation of LINGO3 gene	CTD	PMID:31683443
Lingo3	Rat	4-aminobenzhydrazide	multiple interactions	ISO	LINGO3 (Homo sapiens)	6480464	4-aminobenzhydrazide inhibits the reaction [hydroxyhydroquinone results in decreased expression of LINGO3 mRNA]	CTD	PMID:24530881
Lingo3	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of LINGO3 mRNA	CTD	PMID:24780913
Lingo3	Rat	amphetamine	increases expression	EXP		6480464	Amphetamine results in increased expression of LINGO3 mRNA	CTD	PMID:30779732
Lingo3	Rat	arsane	affects methylation	ISO	LINGO3 (Homo sapiens)	6480464	Arsenic affects the methylation of LINGO3 gene	CTD	PMID:25304211 and PMID:32603190
Lingo3	Rat	arsenic atom	affects methylation	ISO	LINGO3 (Homo sapiens)	6480464	Arsenic affects the methylation of LINGO3 gene	CTD	PMID:25304211 and PMID:32603190
Lingo3	Rat	benzene-1,2,4-triol	decreases expression	ISO	LINGO3 (Homo sapiens)	6480464	hydroxyhydroquinone results in decreased expression of LINGO3 mRNA	CTD	PMID:24530881
Lingo3	Rat	benzene-1,2,4-triol	multiple interactions	ISO	LINGO3 (Homo sapiens)	6480464	4-aminobenzhydrazide inhibits the reaction [hydroxyhydroquinone results in decreased expression of LINGO3 mRNA]	CTD	PMID:24530881
Lingo3	Rat	benzo[a]pyrene	affects methylation	ISO	LINGO3 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of LINGO3 5' UTR and Benzo(a)pyrene affects the methylation of LINGO3 promoter	CTD	PMID:27901495
Lingo3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of LINGO3 mRNA	CTD	PMID:25181051
Lingo3	Rat	cadmium atom	multiple interactions	ISO	LINGO3 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of LINGO3 mRNA	CTD	PMID:35301059
Lingo3	Rat	cadmium dichloride	multiple interactions	ISO	LINGO3 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of LINGO3 mRNA	CTD	PMID:35301059
Lingo3	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of LINGO3 mRNA	CTD	PMID:26033743
Lingo3	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of LINGO3 mRNA	CTD	PMID:26033743
Lingo3	Rat	ethanol	increases expression	ISO	Lingo3 (Mus musculus)	6480464	Ethanol results in increased expression of LINGO3 mRNA	CTD	PMID:30319688
Lingo3	Rat	ethylparaben	decreases expression	ISO	LINGO3 (Homo sapiens)	6480464	ethyl-p-hydroxybenzoate results in decreased expression of LINGO3 mRNA	CTD	PMID:37690743
Lingo3	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of LINGO3 gene	CTD	PMID:22079235
Lingo3	Rat	lipopolysaccharide	decreases expression	ISO	LINGO3 (Homo sapiens)	6480464	Lipopolysaccharides results in decreased expression of LINGO3 mRNA	CTD	PMID:35811015
Lingo3	Rat	lipopolysaccharide	multiple interactions	ISO	LINGO3 (Homo sapiens)	6480464	[S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of LINGO3 mRNA	CTD	PMID:35811015
Lingo3	Rat	metformin	multiple interactions	ISO	LINGO3 (Homo sapiens)	6480464	[Paclitaxel co-treated with Metformin] results in increased expression of LINGO3 mRNA	CTD	PMID:29309887
Lingo3	Rat	paclitaxel	multiple interactions	ISO	LINGO3 (Homo sapiens)	6480464	[Paclitaxel co-treated with Metformin] results in increased expression of LINGO3 mRNA	CTD	PMID:29309887
Lingo3	Rat	resveratrol	multiple interactions	ISO	LINGO3 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of LINGO3 mRNA	CTD	PMID:23557933
Lingo3	Rat	rotenone	increases expression	ISO	LINGO3 (Homo sapiens)	6480464	Rotenone results in increased expression of LINGO3 mRNA	CTD	PMID:29955902
Lingo3	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	LINGO3 (Homo sapiens)	6480464	[S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of LINGO3 mRNA	CTD	PMID:35811015
Lingo3	Rat	triphenyl phosphate	affects expression	ISO	LINGO3 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of LINGO3 mRNA	CTD	PMID:37042841
Lingo3	Rat	triptonide	increases expression	ISO	Lingo3 (Mus musculus)	6480464	triptonide results in increased expression of LINGO3 mRNA	CTD	PMID:33045310
Lingo3	Rat	valproic acid	increases methylation	ISO	LINGO3 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of LINGO3 gene	CTD	PMID:29154799

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lingo3	Rat	extracellular matrix	is_active_in	IBA	MGI:3036284 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Lingo3	Rat	extracellular space	is_active_in	IBA	FB:FBgn0268063 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Lingo3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,519,252 - 9,530,675 (+)	NCBI		GRCr8
mRatBN7.2	7	8,869,025 - 8,878,431 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,869,025 - 8,878,431 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	11,753,044 - 11,762,461 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,628,548 - 13,637,965 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,495,081 - 11,504,496 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,737,293 - 11,746,703 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,737,293 - 11,746,703 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	11,905,008 - 11,914,418 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	10,379,660 - 10,389,070 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	7,053,134 - 7,062,544 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

LINGO3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	2,287,164 - 2,308,154 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	2,287,164 - 2,308,154 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	2,287,163 - 2,308,153 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	2,240,774 - 2,259,156 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	2,240,998 - 2,243,023	NCBI
Celera	19	2,223,699 - 2,242,250 (-)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	2,061,655 - 2,063,324 (-)	NCBI		HuRef
CHM1_1	19	2,289,362 - 2,307,712 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	2,260,807 - 2,281,793 (-)	NCBI		T2T-CHM13v2.0

Lingo3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	80,668,635 - 80,679,873 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	80,668,635 - 80,679,873 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	80,832,801 - 80,844,039 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	80,832,801 - 80,844,039 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	80,295,546 - 80,306,784 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	80,235,930 - 80,247,159 (-)	NCBI		MGSCv36	mm8
Celera	10	81,851,599 - 81,862,837 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Lingo3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	5,860,126 - 5,861,939 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	5,850,956 - 5,862,249 (+)	NCBI	ChiLan1.0	ChiLan1.0

LINGO3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	6,672,881 - 6,691,244 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	5,902,227 - 5,920,590 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	1,299,345 - 1,317,706 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

LINGO3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	56,755,986 - 56,757,919 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	56,551,520 - 56,555,841 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	57,489,312 - 57,493,633 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	57,479,171 - 57,493,653 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	56,541,372 - 56,545,693 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	57,026,564 - 57,030,880 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	57,226,955 - 57,231,276 (+)	NCBI		UU_Cfam_GSD_1.0

Lingo3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	216,461,823 - 216,466,729 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	1,369,707 - 1,371,485 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	1,368,048 - 1,372,364 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LINGO3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	76,264,071 - 76,280,623 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	76,264,077 - 76,280,627 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	76,825,890 - 76,843,050 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LINGO3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	2,081,234 - 2,103,094 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	2,082,224 - 2,084,002 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666081	6,609,756 - 6,628,671 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lingo3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	6,592,957 - 6,609,665 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	6,592,941 - 6,609,698 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Lingo3
39 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	54
Count of miRNA genes:	46
Interacting mature miRNAs:	51
Transcripts:	ENSRNOT00000046059
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	11	13	113	59	58	27	25	27	6	135	61	93	31	58	31


RefSeq Transcripts	NM_001109609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264283	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000046059 ⟹ ENSRNOP00000051446

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	8,869,025 - 8,878,431 (+)	Ensembl
Rnor_6.0 Ensembl	7	11,737,293 - 11,746,703 (+)	Ensembl

RefSeq Acc Id:

NM_001109609 ⟹ NP_001103079

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,519,698 - 9,529,106 (+)	NCBI
mRatBN7.2	7	8,869,025 - 8,878,431 (+)	NCBI
Rnor_6.0	7	11,737,293 - 11,746,703 (+)	NCBI
Rnor_5.0	7	11,905,008 - 11,914,418 (+)	NCBI
RGSC_v3.4	7	10,379,660 - 10,389,070 (+)	RGD
Celera	7	7,053,134 - 7,062,544 (+)	RGD

Sequence:

show sequence

CAGAGCCCGGGAGGTGGCGGTGGCGGTGGCGGCGGCTGGTGGCGGCTGGTGGCTGCTCCGAGCGGCCCCCCGCGCCGTCCAAGGAGGAGCCGCCCAGCTGTCCTGGACTATGCTGGCGAGGCCCTAGG
CCCAGACCTTACACCATGACCTGCTGGCTGCACATGCTGGGCCTGCACTTGCTGCTGCTGCCCACAGCGCCCCTGGCCACAGGCTGCCCCGCACGCTGCGAGTGCTCCGCGTCCACTCGTACTGTGGC
CTGCGGGCGCCGCCGGCTGACCGCCGTACCCGAAGGCATCCCGGCAGAGACACGGATGCTGGAGCTGAGCCGCAACCGCATCCGCTGCCTGAACCCCGGGGACCTGGCCTCGCTGCCCACCCTGGAGG
AGCTGGACCTCAACCATAACGTGATCGCCCACGTGGAACCTGGGGCCTTCGCCAACCTGCCCCGCCTGCGCGTCCTGCGTCTCCGTGGCAACCAGCTGAAGCTCATCCCGCCAGGCGTGTTCACACAT
CTGGACAGCCTCACGCTGCTGGACCTGAGCGAGAACAAACTGGTCATCCTGCTGGATTTCAGCTTCCAGGACCTGCGCAGCCTGCAGCGGCTGGAGGTGGGCGATAACGACCTGGTGTTCATCTCCCG
CAGGGCCTTCGCGGGGCTGCTGGGGCTGGCTGAGCTCACGCTGGAGCGCTGCAATCTCACGTCGCTGTCCCCGGAGTCGCTGGGTCACCTGCGGGGCTTGGGCGCTCTGCGCCTGCGCCACCTGGCCA
TTGCCGCCCTGGAGGACCAGAATTTCCAGAAGCTTCCGGGACTCTTACATCTGGAGATTGACAACTGGCCGCTGCTGGAGGAGGTAGCCCCGGGCAGCCTGCGTGGGCTGAACCTCACCTCGCTGTCC
ATCACGCACACCAACATCACGGCTGTGCCGGCCGCCGCGCTGCGACAGCAGGCCCACCTCACGTGCCTCAACCTGTCGCACAACCCCATCAGCATGGTGCCACGCGGCTCCTTCAGAGACCTGGTGCG
CCTGCGCGAGCTTCACCTAGCAGGAGCCCTGCTGGCCGTCATCGAGCCGCAGGCCTTCGTGGGGCTGCGACAGATCCGCCTGCTCAACCTCTCAGACAACCTGCTGTCCACGCTGGAGGAGAACACGT
TCCACTCCGTGAACACGCTCGAGACGCTGCGCGTGGACGGCAACCCTCTGGCCTGCGACTGTCGCCTGCTGTGGATCGTGCAGAGGAGGAAGACCCTGAACTTTGACGGCAGGCTCCCCGCCTGCGCC
ACCCCCGCCGAGGTGCGCGGCGACGCCTTGCACAACCTCCCTGACTCCGTGCTCTTCGAGTACTTCGTGTGTCGCAAGCCCAAGATCCGGGAGAGACGGCTGCAGCATGTGACCGCCACCGAGGGTGA
CGACGTGCGCTTTCTGTGCCGCGCTGAGGGCGAGCCTGCGCCCACGGTGGCCTGGGTGACGCCCCAGCACCACTCCGTTACGGCTGCCAGCCGGGGCCGGGCACGAGTGCTGCCTGGGGGCACCCTGG
CCATCACAGACACGCGGCCTCAGGACAGTGGCACCTACACGTGTGTGGCCAGCAACGCCGGGGGTAACGACACTTATTTCGCCACCTTGACCATCCATCCGGCTGCCAACCGGACCCAGAGCGATGGG
CACAACGAGACGCAGGTGGGCGTTCGGTTCCCTCTGGACCTCACCACCATTCTTGTGTCCACCGCCATGGGGTGCATCACCTTCCTGGGCGTGGTCCTCTTCTGCTTTCTGCTGCTCTTTGTGTGGAG
CCGCGGCCGTGGACAGCACAAGAATAACTTCTCTGTGGAATATTCCTTCCGCAAGGTGGACGGTCCAGCGGCTGCGGCTGGCCAGGGTGGCGCACGCAAGTTCAACATGAAGATGATCTGA

hide sequence

RefSeq Acc Id:

XM_063264283 ⟹ XP_063120353

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,519,252 - 9,530,675 (+)	NCBI


Protein RefSeqs	NP_001103079	(Get FASTA)	NCBI Sequence Viewer
	XP_063120353	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL89221	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000051446
	ENSRNOP00000051446.3
	ENSRNOP00000110002

RefSeq Acc Id:	NP_001103079 ⟸ NM_001109609
- Peptide Label:	precursor
- UniProtKB:	D3ZW19 (UniProtKB/TrEMBL), A6K8F1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTCWLHMLGLHLLLLPTAPLATGCPARCECSASTRTVACGRRRLTAVPEGIPAETRMLELSRNRIRCLNPGDLASLPTLEELDLNHNVIAHVEPGAFANLPRLRVLRLRGNQLKLIPPGVFTHLDSLT LLDLSENKLVILLDFSFQDLRSLQRLEVGDNDLVFISRRAFAGLLGLAELTLERCNLTSLSPESLGHLRGLGALRLRHLAIAALEDQNFQKLPGLLHLEIDNWPLLEEVAPGSLRGLNLTSLSITHTN ITAVPAAALRQQAHLTCLNLSHNPISMVPRGSFRDLVRLRELHLAGALLAVIEPQAFVGLRQIRLLNLSDNLLSTLEENTFHSVNTLETLRVDGNPLACDCRLLWIVQRRKTLNFDGRLPACATPAEV RGDALHNLPDSVLFEYFVCRKPKIRERRLQHVTATEGDDVRFLCRAEGEPAPTVAWVTPQHHSVTAASRGRARVLPGGTLAITDTRPQDSGTYTCVASNAGGNDTYFATLTIHPAANRTQSDGHNETQ VGVRFPLDLTTILVSTAMGCITFLGVVLFCFLLLFVWSRGRGQHKNNFSVEYSFRKVDGPAAAAGQGGARKFNMKMI hide sequence

Ensembl Acc Id:

ENSRNOP00000051446 ⟸ ENSRNOT00000046059

RefSeq Acc Id:	XP_063120353 ⟸ XM_063264283
- Peptide Label:	isoform X1

Protein Domains

Ig-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZW19-F1-model_v2	AlphaFold	D3ZW19	1-589	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13695001

Promoter ID:

EPDNEW_R5525

Type:

single initiation site

Name:

Lingo3_1

Description:

leucine rich repeat and Ig domain containing 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	11,737,320 - 11,737,380	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-34972	BioCyc
Ensembl Genes	ENSRNOG00000032569	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000046059	ENTREZGENE
	ENSRNOT00000046059.4	UniProtKB/TrEMBL
	ENSRNOT00000159580	ENTREZGENE
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
	3.80.10.10	UniProtKB/TrEMBL
InterPro	Cys-rich_flank_reg_C	UniProtKB/TrEMBL
	Ig-like	UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	Ig_I-set	UniProtKB/TrEMBL
	Ig_sub	UniProtKB/TrEMBL
	Ig_sub2	UniProtKB/TrEMBL
	L_dom-like	UniProtKB/TrEMBL
	Leu-rich_rpt	UniProtKB/TrEMBL
	Leu-rich_rpt_typical-subtyp	UniProtKB/TrEMBL
	LRFN	UniProtKB/TrEMBL
	LRR-contain_N	UniProtKB/TrEMBL
KEGG Report	rno:690755	UniProtKB/TrEMBL
NCBI Gene	690755	ENTREZGENE
PANTHER	CARBOXYPEPTIDASE N SUBUNIT 2-LIKE	UniProtKB/TrEMBL
	SYNAPTIC ADHESION-LIKE MOLECULE SALM	UniProtKB/TrEMBL
Pfam	I-set	UniProtKB/TrEMBL
	LRR_1	UniProtKB/TrEMBL
	LRR_8	UniProtKB/TrEMBL
PhenoGen	Lingo3	PhenoGen
PROSITE	IG_LIKE	UniProtKB/TrEMBL
	LRR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000032569	RatGTEx
SMART	IGc2	UniProtKB/TrEMBL
	LRR_TYP	UniProtKB/TrEMBL
	LRRCT	UniProtKB/TrEMBL
	LRRNT	UniProtKB/TrEMBL
	SM00409	UniProtKB/TrEMBL
Superfamily-SCOP	L domain-like	UniProtKB/TrEMBL
	SSF48726	UniProtKB/TrEMBL
UniProt	A6K8F1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZW19	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-09	LOC690755	similar to leucine rich repeat neuronal 6C	LOC686868	similar to leucine rich repeat neuronal 6C	Data merged from RGD:1592486	737654	APPROVED
2008-10-09	Lingo3	leucine rich repeat and Ig domain containing 3	LOC690755	similar to leucine rich repeat neuronal 6C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC686868	similar to leucine rich repeat neuronal 6C			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC690755	similar to leucine rich repeat neuronal 6C			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar