Advanced Search (OLGA)

Gene: Cimip1 (ciliary microtubule inner protein 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Cimip1

Name:

ciliary microtubule inner protein 1

RGD ID:

1589960

Description:

Predicted to be located in cilium. Orthologous to human CIMIP1 (ciliary microtubule inner protein 1); INTERACTS WITH bisphenol A; benzo[a]pyrene (ortholog); methotrexate (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C3h20orf85; hypothetical protein LOC689618; LOC689618; similar to human chromosome 20 open reading frame 85; similar to Protein C20orf85 homolog; uncharacterized protein C20orf85 homolog; uncharacterized protein LOC689618

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	182,733,242 - 182,740,733 (+)	NCBI		GRCr8
mRatBN7.2	3	162,315,542 - 162,322,456 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	162,315,622 - 162,322,455 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	166,114,698 - 166,121,529 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	174,618,539 - 174,625,370 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	172,355,492 - 172,362,323 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	171,597,319 - 171,604,094 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	171,597,241 - 171,604,143 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	177,658,756 - 177,665,531 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	164,407,395 - 164,414,314 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	161,501,291 - 161,508,086 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cimip1	Rat	benzo[a]pyrene	increases methylation	ISO	CIMIP1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of CIMIP1 5' UTR and Benzo(a)pyrene results in increased methylation of CIMIP1 promoter	CTD	PMID:27901495
Cimip1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CIMIP1 mRNA	CTD	PMID:25181051
Cimip1	Rat	methotrexate	increases expression	ISO	CIMIP1 (Homo sapiens)	6480464	Methotrexate results in increased expression of CIMIP1 mRNA	CTD	PMID:24449571

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cimip1	Rat	cilium	located_in	ISO	CIMIP1 (Homo sapiens)	1624291	PMID:25786037	RGD	PMID:25786037
Cimip1	Rat	cilium	located_in	IEA	UniProtKB:Q9H1P6 and ensembl:ENSP00000360210	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cimip1	Rat	protein binding	enables	ISO	CIMIP1 (Homo sapiens)	1624291	UniProtKB:O14936-4 more ...	RGD	PMID:32296183

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Cimip1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	182,733,242 - 182,740,733 (+)	NCBI		GRCr8
mRatBN7.2	3	162,315,542 - 162,322,456 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	162,315,622 - 162,322,455 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	166,114,698 - 166,121,529 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	174,618,539 - 174,625,370 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	172,355,492 - 172,362,323 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	171,597,319 - 171,604,094 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	171,597,241 - 171,604,143 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	177,658,756 - 177,665,531 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	164,407,395 - 164,414,314 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	161,501,291 - 161,508,086 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

CIMIP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	58,150,902 - 58,161,150 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	58,150,902 - 58,161,150 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	56,725,958 - 56,736,206 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	56,159,389 - 56,169,592 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	56,159,388 - 56,169,587	NCBI
Celera	20	53,466,441 - 53,476,642 (+)	NCBI		Celera
Cytogenetic Map	20	q13.32	NCBI
HuRef	20	53,508,254 - 53,518,458 (+)	NCBI		HuRef
CHM1_1	20	56,627,541 - 56,637,743 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	59,930,302 - 59,940,549 (+)	NCBI		T2T-CHM13v2.0

Cimip1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	173,364,385 - 173,370,295 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	173,364,379 - 173,370,294 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	173,522,592 - 173,528,502 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	173,522,586 - 173,528,501 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	173,348,093 - 173,354,003 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	173,165,537 - 173,171,440 (+)	NCBI		MGSCv36	mm8
Celera	2	179,488,998 - 179,495,238 (+)	NCBI		Celera
Cytogenetic Map	2	H4	NCBI
cM Map	2	96.88	NCBI

Cimip1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	1,357,173 - 1,370,771 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955445	1,360,659 - 1,370,748 (-)	NCBI	ChiLan1.0	ChiLan1.0

CIMIP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	63,900,612 - 63,919,664 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	63,893,731 - 63,909,576 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	54,494,076 - 54,504,703 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	55,770,571 - 55,780,802 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	55,770,571 - 55,783,620 (+)	Ensembl	panpan1.1		panPan2

CIMIP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	42,960,156 - 42,968,514 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	42,960,214 - 42,969,258 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	42,207,018 - 42,228,510 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	43,825,900 - 43,847,428 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	43,825,958 - 43,838,373 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	42,928,414 - 42,936,741 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	43,049,479 - 43,071,004 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	43,707,868 - 43,729,373 (+)	NCBI		UU_Cfam_GSD_1.0

Cimip1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	182,541,774 - 182,548,910 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936530	757,396 - 764,198 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936530	757,396 - 764,198 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CIMIP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	58,373,175 - 58,383,131 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	58,373,168 - 58,383,135 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	65,584,607 - 65,594,592 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CIMIP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	5,971,913 - 5,982,108 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	5,971,474 - 5,982,161 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	54,026,368 - 54,036,563 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cimip1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	24,482,358 - 24,489,495 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	24,482,338 - 24,489,508 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cimip1
46 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	51
Count of miRNA genes:	48
Interacting mature miRNAs:	50
Transcripts:	ENSRNOT00000029558
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	145925360	166177555	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145925360	166177555	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	145925360	166177555	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	145925360	166177555	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	145925360	166177555	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	145925360	166177555	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
1300161	Rf10	Renal function QTL 10	3.57		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	3	161192952	169034231	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	145956084	169034231	Rat
2317883	Alcrsp26	Alcohol response QTL 26	1.8	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	3	145526770	169034231	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	149040888	168026850	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	145925360	166177555	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat

RH141945

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	162,322,269 - 162,322,419 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	171,603,909 - 171,604,058	NCBI	Rnor6.0
Rnor_5.0	3	177,665,346 - 177,665,495	UniSTS	Rnor5.0
RGSC_v3.4	3	164,414,129 - 164,414,278	UniSTS	RGSC3.4
Celera	3	161,507,901 - 161,508,050	UniSTS
RH 3.4 Map	3	1496.9	UniSTS
Cytogenetic Map	3	q42	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
6	5	1	19	15	12	5	10	5	33	16	15	2	37	7


RefSeq Transcripts	NM_001109542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284577	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000029558 ⟹ ENSRNOP00000030660

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	162,315,622 - 162,322,455 (+)	Ensembl
Rnor_6.0 Ensembl	3	171,597,241 - 171,604,143 (+)	Ensembl

RefSeq Acc Id:

NM_001109542 ⟹ NP_001103012

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	182,733,901 - 182,740,732 (+)	NCBI
mRatBN7.2	3	162,315,622 - 162,322,455 (+)	NCBI
Rnor_6.0	3	171,597,319 - 171,604,094 (+)	NCBI
Rnor_5.0	3	177,658,756 - 177,665,531 (+)	NCBI
RGSC_v3.4	3	164,407,395 - 164,414,314 (+)	RGD
Celera	3	161,501,291 - 161,508,086 (+)	RGD

Sequence:

show sequence

AGTCGAGGGTAGGAGCACACGGGTTTGGGTTTGCGGAGACTCCGGGATCCATGGCGCAGAAACCGCTCAGTACCACCGCCGCAGAGCGCATGAACCTTGTGGCCCAGGACGAGATCTGGAAATACCGT
CTGAAGGCCGAAAGTGAAGCCCGGCAAAACTGGCCGTCGAAGTGGGGATATTTAACAACCTCCATGAAAGAGCTGCTCGAGGGTGACGAGGAACCACATACCCCAAAGCCCAAGGTCGAGCTGCCCAG
CCACTTCCGTGTCCATCCAGTGAGCCCCTTGGATAAATACATCAAGATTCTCCCATCGCCTCCAGTCCCAAAGACCACCCAGGGCTTCATCGGGTGGCGATCTGGTCTGCCCCTGTACTGCTTGGAGA
AGTACACAGAGATTCGCAGCTGCAAAGGGGCTTACGCCCGAGACCTGCGCTGGCCTAAGCAAGGCGTGCACTGAGCACCACCAGCGTCTGCCTGGGGCAGGCTGTGTGCTGTGCCTGGGTGAGCATCC
CTGATGTTTTGAAGAACAACAGGTTGCCTTGGCATTGTCATTTGTTGGCACTTCTGGCATTGCCAGCTAACGTAAAGTAAAACAGATACCCTGGTTT

hide sequence

RefSeq Acc Id:

XM_063284577 ⟹ XP_063140647

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	182,733,242 - 182,740,733 (+)	NCBI


Protein RefSeqs	NP_001103012	(Get FASTA)	NCBI Sequence Viewer
	XP_063140647	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL85112	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000030660
	ENSRNOP00000030660.2

RefSeq Acc Id:	NP_001103012 ⟸ NM_001109542
- UniProtKB:	D4A8H6 (UniProtKB/TrEMBL), A6KL04 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAQKPLSTTAAERMNLVAQDEIWKYRLKAESEARQNWPSKWGYLTTSMKELLEGDEEPHTPKPKVELPSHFRVHPVSPLDKYIKILPSPPVPKTTQGFIGWRSGLPLYCLEKYTEIRSCKGAYARDLR WPKQGVH hide sequence

Ensembl Acc Id:

ENSRNOP00000030660 ⟸ ENSRNOT00000029558

RefSeq Acc Id:	XP_063140647 ⟸ XM_063284577
- Peptide Label:	isoform X1
- UniProtKB:	A6KL04 (UniProtKB/TrEMBL), D4A8H6 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A8H6-F1-model_v2	AlphaFold	D4A8H6	1-135	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692714

Promoter ID:

EPDNEW_R3239

Type:

initiation region

Name:

LOC689618_1

Description:

similar to Protein C20orf85 homolog

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	171,597,303 - 171,597,363	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-46489	BioCyc
Ensembl Genes	ENSRNOG00000028533	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000029558	ENTREZGENE
	ENSRNOT00000029558.4	UniProtKB/TrEMBL
InterPro	Uncharacterised_C20orf85	UniProtKB/TrEMBL
KEGG Report	rno:689618	UniProtKB/TrEMBL
NCBI Gene	689618	ENTREZGENE
PANTHER	CHROMOSOME 20 ORF85 FAMILY MEMBER	UniProtKB/TrEMBL
	RCG40914	UniProtKB/TrEMBL
Pfam	LLC1	UniProtKB/TrEMBL
PhenoGen	Cimip1	PhenoGen
RatGTEx	ENSRNOG00000028533	RatGTEx
UniProt	A6KL04	ENTREZGENE, UniProtKB/TrEMBL
	D4A8H6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-05-05	Cimip1	ciliary microtubule inner protein 1	C3h20orf85	similar to human chromosome 20 open reading frame 85	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2022-08-02	C3h20orf85	similar to human chromosome 20 open reading frame 85	LOC689618	similar to Protein C20orf85 homolog	Name and Symbol changed	629549	APPROVED
2008-01-09	LOC689618	similar to Protein C20orf85 homolog	LOC679098	similar to Protein C20orf85 homolog	Data merged from RGD:1593029	1643240	APPROVED
2006-11-20	LOC689618	similar to Protein C20orf85 homolog			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC679098	similar to Protein C20orf85 homolog			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message