Advanced Search (OLGA)

Gene: Yaf2 (YY1 associated factor 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Yaf2

Name:

YY1 associated factor 2

RGD ID:

1582851

Description:

Predicted to enable DNA binding activity; transcription coactivator activity; and transcription corepressor activity. Predicted to be involved in negative regulation of DNA-templated transcription and positive regulation of DNA-templated transcription. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in nucleus. Orthologous to human YAF2 (YY1 associated factor 2); INTERACTS WITH 6-propyl-2-thiouracil; amitrole; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC690262; similar to YY1-associated factor 2; YY1-associated factor 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	YAF2 (YY1 associated factor 2)	HGNC	Ensembl, Inparanoid, NCBI, OMA, Panther
Mus musculus (house mouse):	Yaf2 (YY1 associated factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Yaf2 (YY1 associated factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	YAF2 (YY1 associated factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	YAF2 (YY1 associated factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Yaf2 (YY1 associated factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	YAF2 (YY1 associated factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	YAF2 (YY1 associated factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Yaf2 (YY1 associated factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	YAF2 (YY1 associated factor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Yaf2 (YY1 associated factor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	yaf2 (YY1 associated factor 2)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RYBP	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tag-294	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	yaf2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	126,323,604 - 126,379,061 (-)	NCBI		GRCr8
mRatBN7.2	7	124,444,152 - 124,499,688 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	124,444,152 - 124,499,928 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	126,218,353 - 126,274,001 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	128,444,204 - 128,499,870 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	128,366,016 - 128,421,115 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	134,505,352 - 134,560,713 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	134,505,737 - 134,560,713 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	134,175,947 - 134,230,702 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	131,771,036 - 131,825,986 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	120,842,232 - 120,897,579 (-)	NCBI		Celera
Cytogenetic Map	7	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Yaf2	Rat	amenorrhea		ISO	YAF2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Primary amenorrhea	ClinVar	PMID:21681106

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Yaf2	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Yaf2 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of YAF2 mRNA	CTD	PMID:36331819
Yaf2	Rat	1,2-dichloroethane	decreases expression	ISO	Yaf2 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of YAF2 mRNA	CTD	PMID:28189721 and PMID:28960355
Yaf2	Rat	1,2-dimethylhydrazine	increases expression	ISO	Yaf2 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of YAF2 mRNA	CTD	PMID:22206623
Yaf2	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Yaf2 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of YAF2 mRNA]	CTD	PMID:22206623
Yaf2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Yaf2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of YAF2 mRNA	CTD	PMID:19770486
Yaf2	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	YAF2 (Homo sapiens)	6480464	bisphenol S results in increased methylation of YAF2 gene	CTD	PMID:31601247
Yaf2	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of YAF2 mRNA	CTD	PMID:30047161
Yaf2	Rat	acetaldehyde	increases expression	ISO	YAF2 (Homo sapiens)	6480464	Acetaldehyde results in increased expression of YAF2 mRNA	CTD	PMID:23416264
Yaf2	Rat	acrolein	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of YAF2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of YAF2 mRNA	CTD	PMID:32699268
Yaf2	Rat	alpha-pinene	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of YAF2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of YAF2 mRNA	CTD	PMID:32699268
Yaf2	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of YAF2 mRNA	CTD	PMID:30047161
Yaf2	Rat	arsane	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YAF2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of YAF2 mRNA	CTD	PMID:39836092
Yaf2	Rat	arsenic atom	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YAF2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of YAF2 mRNA	CTD	PMID:39836092
Yaf2	Rat	benzo[a]pyrene	increases expression	ISO	YAF2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of YAF2 mRNA	CTD	PMID:17879257
Yaf2	Rat	benzo[a]pyrene	increases methylation	ISO	YAF2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of YAF2 promoter	CTD	PMID:27901495
Yaf2	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Yaf2 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of YAF2 mRNA	CTD	PMID:19850644
Yaf2	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	Yaf2 (Mus musculus)	6480464	PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of YAF2 mRNA]	CTD	PMID:19850644
Yaf2	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of YAF2 mRNA	CTD	PMID:25181051
Yaf2	Rat	bisphenol A	decreases methylation	ISO	YAF2 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of YAF2 gene	CTD	PMID:31601247
Yaf2	Rat	bisphenol A	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of YAF2 gene	CTD	PMID:31601247
Yaf2	Rat	cadmium dichloride	increases expression	ISO	YAF2 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of YAF2 mRNA	CTD	PMID:38568856
Yaf2	Rat	caffeine	increases phosphorylation	ISO	YAF2 (Homo sapiens)	6480464	Caffeine results in increased phosphorylation of YAF2 protein	CTD	PMID:35688186
Yaf2	Rat	carbamazepine	affects expression	ISO	YAF2 (Homo sapiens)	6480464	Carbamazepine affects the expression of YAF2 mRNA	CTD	PMID:25979313
Yaf2	Rat	CGP 52608	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to YAF2 gene]	CTD	PMID:28238834
Yaf2	Rat	cisplatin	decreases expression	ISO	YAF2 (Homo sapiens)	6480464	Cisplatin results in decreased expression of YAF2 mRNA	CTD	PMID:27392435
Yaf2	Rat	cisplatin	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of YAF2 mRNA	CTD	PMID:27392435
Yaf2	Rat	copper(II) sulfate	increases expression	ISO	YAF2 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of YAF2 mRNA	CTD	PMID:19549813
Yaf2	Rat	cyclosporin A	increases expression	ISO	YAF2 (Homo sapiens)	6480464	Cyclosporine results in increased expression of YAF2 mRNA	CTD	PMID:25562108
Yaf2	Rat	Dibutyl phosphate	affects expression	ISO	YAF2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of YAF2 mRNA	CTD	PMID:37042841
Yaf2	Rat	dibutyl phthalate	increases expression	ISO	Yaf2 (Mus musculus)	6480464	Dibutyl Phthalate results in increased expression of YAF2 mRNA	CTD	PMID:21266533
Yaf2	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of YAF2 mRNA	CTD	PMID:21266533
Yaf2	Rat	doxorubicin	decreases expression	ISO	YAF2 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of YAF2 mRNA	CTD	PMID:29803840
Yaf2	Rat	ethanol	multiple interactions	ISO	Yaf2 (Mus musculus)	6480464	Ethanol affects the expression of and affects the splicing of YAF2 mRNA	CTD	PMID:30319688
Yaf2	Rat	ethanol	affects expression	ISO	Yaf2 (Mus musculus)	6480464	Ethanol affects the expression of YAF2 mRNA	CTD	PMID:30319688
Yaf2	Rat	folic acid	multiple interactions	ISO	Yaf2 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of YAF2 mRNA]	CTD	PMID:22206623
Yaf2	Rat	FR900359	affects phosphorylation	ISO	YAF2 (Homo sapiens)	6480464	FR900359 affects the phosphorylation of YAF2 protein	CTD	PMID:37730182
Yaf2	Rat	fulvestrant	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of YAF2 gene	CTD	PMID:31601247
Yaf2	Rat	inulin	multiple interactions	ISO	Yaf2 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of YAF2 mRNA	CTD	PMID:36331819
Yaf2	Rat	irinotecan	decreases expression	ISO	YAF2 (Homo sapiens)	6480464	Irinotecan analog results in decreased expression of YAF2 mRNA	CTD	PMID:18927307
Yaf2	Rat	manganese atom	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YAF2 mRNA	CTD	PMID:39836092
Yaf2	Rat	manganese(0)	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YAF2 mRNA	CTD	PMID:39836092
Yaf2	Rat	manganese(II) chloride	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YAF2 mRNA	CTD	PMID:39836092
Yaf2	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of YAF2 mRNA	CTD	PMID:30047161
Yaf2	Rat	monosodium L-glutamate	multiple interactions	ISO	Yaf2 (Mus musculus)	6480464	[Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of YAF2 mRNA	CTD	PMID:22078008
Yaf2	Rat	nitrates	multiple interactions	ISO	Yaf2 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of YAF2 mRNA	CTD	PMID:35964746
Yaf2	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of YAF2 mRNA	CTD	PMID:25729387
Yaf2	Rat	ozone	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of YAF2 mRNA more ...	CTD	PMID:32699268
Yaf2	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Yaf2 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of YAF2 mRNA more ...	CTD	PMID:36331819
Yaf2	Rat	phenobarbital	affects expression	ISO	YAF2 (Homo sapiens)	6480464	Phenobarbital affects the expression of YAF2 mRNA	CTD	PMID:19159669
Yaf2	Rat	pirinixic acid	increases expression	ISO	Yaf2 (Mus musculus)	6480464	pirinixic acid results in increased expression of YAF2 mRNA	CTD	PMID:17426115 and PMID:18301758
Yaf2	Rat	resveratrol	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of YAF2 mRNA	CTD	PMID:23557933
Yaf2	Rat	sodium arsenite	multiple interactions	ISO	YAF2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YAF2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of YAF2 mRNA	CTD	PMID:39836092
Yaf2	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of YAF2 mRNA	CTD	PMID:30047161
Yaf2	Rat	sunitinib	decreases expression	ISO	YAF2 (Homo sapiens)	6480464	Sunitinib results in decreased expression of YAF2 mRNA	CTD	PMID:31533062
Yaf2	Rat	titanium dioxide	decreases methylation	ISO	Yaf2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of YAF2 gene and titanium dioxide results in decreased methylation of YAF2 promoter	CTD	PMID:35295148
Yaf2	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of YAF2 mRNA	CTD	PMID:25729387

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Yaf2	Rat	negative regulation of DNA-templated transcription	involved_in	ISO	YAF2 (Homo sapiens)	1624291	PMID:12706874	RGD	PMID:12706874
Yaf2	Rat	positive regulation of DNA-templated transcription	involved_in	ISO	YAF2 (Homo sapiens)	1624291	PMID:11593398	RGD	PMID:11593398
Yaf2	Rat	positive regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR039958	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Yaf2	Rat	regulation of DNA-templated transcription	involved_in	IBA	MGI:1929059 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Yaf2	Rat	cytosol	located_in	ISO	YAF2 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Yaf2	Rat	nucleoplasm	located_in	ISO	YAF2 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Yaf2	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Yaf2	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Yaf2	Rat	nucleus	is_active_in	IBA	FB:FBgn0034763 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Yaf2	Rat	nucleus	located_in	ISO	YAF2 (Homo sapiens)	1624291	PMID:11593398	RGD	PMID:11593398
Yaf2	Rat	nucleus	located_in	ISO	Yaf2 (Mus musculus)	1624291	PMID:14557078	RGD	PMID:14557078

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Yaf2	Rat	DNA binding	enables	IBA	FB:FBgn0034763 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Yaf2	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Yaf2	Rat	protein binding	enables	ISO	YAF2 (Homo sapiens)	1624291	UniProtKB:P01106 more ...	RGD	PMID:11593398 more ...
Yaf2	Rat	protein binding	enables	ISO	Yaf2 (Mus musculus)	1624291	PR:P22227 more ...	RGD	PMID:14557078 and PMID:21530438
Yaf2	Rat	protein binding	enables	ISO	YAF2 (Homo sapiens) and UniProtKB:Q8IY57-5	1624291	UniProtKB:G5E9A7 more ...	RGD	PMID:32296183 and PMID:32814053
Yaf2	Rat	transcription coactivator activity	enables	ISO	YAF2 (Homo sapiens)	1624291	PMID:11593398	RGD	PMID:11593398
Yaf2	Rat	transcription coregulator activity	enables	IBA	MGI:1929059 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Yaf2	Rat	transcription corepressor activity	enables	ISO	YAF2 (Homo sapiens)	1624291	PMID:12706874	RGD	PMID:12706874
Yaf2	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11593398	PMID:12706874	PMID:14557078	PMID:35963157

Yaf2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	126,323,604 - 126,379,061 (-)	NCBI		GRCr8
mRatBN7.2	7	124,444,152 - 124,499,688 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	124,444,152 - 124,499,928 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	126,218,353 - 126,274,001 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	128,444,204 - 128,499,870 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	128,366,016 - 128,421,115 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	134,505,352 - 134,560,713 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	134,505,737 - 134,560,713 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	134,175,947 - 134,230,702 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	131,771,036 - 131,825,986 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	120,842,232 - 120,897,579 (-)	NCBI		Celera
Cytogenetic Map	7	q35	NCBI

YAF2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	42,157,104 - 42,238,248 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	42,157,104 - 42,238,349 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	42,550,906 - 42,632,050 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	40,837,173 - 40,918,317 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	40,837,175 - 40,918,317	NCBI
Celera	12	41,352,740 - 41,433,972 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI
HuRef	12	39,578,266 - 39,658,535 (-)	NCBI		HuRef
CHM1_1	12	42,516,314 - 42,598,716 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	42,115,009 - 42,196,195 (-)	NCBI		T2T-CHM13v2.0

Yaf2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	93,181,714 - 93,234,816 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	93,182,159 - 93,234,816 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	93,283,833 - 93,336,935 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	93,284,278 - 93,336,935 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	93,114,264 - 93,167,366 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	93,112,078 - 93,165,087 (-)	NCBI		MGSCv36	mm8
Celera	15	95,427,934 - 95,480,526 (-)	NCBI		Celera
Cytogenetic Map	15	E3	NCBI
cM Map	15	47.39	NCBI

Yaf2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955500	1,531,884 - 1,559,892 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955500	1,531,884 - 1,626,335 (-)	NCBI	ChiLan1.0	ChiLan1.0

YAF2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	51,921,778 - 51,998,654 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	51,918,589 - 51,995,404 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	46,479,251 - 46,558,030 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	47,343,211 - 47,420,286 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	47,343,211 - 47,420,286 (+)	Ensembl	panpan1.1		panPan2

YAF2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	11,676,243 - 11,746,118 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	11,675,909 - 11,744,683 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	34,557,231 - 34,627,360 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	11,872,512 - 11,942,648 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	11,872,436 - 11,949,313 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	11,690,377 - 11,760,588 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	11,720,972 - 11,791,255 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	34,803,552 - 34,873,633 (-)	NCBI		UU_Cfam_GSD_1.0

Yaf2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	72,163,301 - 72,243,516 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936512	928,893 - 1,002,061 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936512	927,751 - 1,001,515 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

YAF2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	73,411,038 - 73,497,180 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	73,411,029 - 73,497,347 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

YAF2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	38,391,203 - 38,469,679 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	208,102,162 - 208,183,396 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Yaf2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624917	1,978,168 - 2,074,149 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624917	1,975,472 - 2,074,305 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Yaf2
228 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	168
Count of miRNA genes:	124
Interacting mature miRNAs:	149
Transcripts:	ENSRNOT00000006621
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1354582	Stl11	Serum triglyceride level QTL 11	3.42		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	119513385	135012528	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	116677189	127103496	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
1357339	Stl14	Serum triglyceride level QTL 14	3.45	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	112729683	133492707	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	112308254	133492884	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

D7Got115

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	126,332,491 - 126,332,634 (+)	Marker Load Pipeline
mRatBN7.2	7	124,453,039 - 124,453,182 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	134,514,240 - 134,514,382	NCBI	Rnor6.0
Rnor_5.0	7	134,184,450 - 134,184,592	UniSTS	Rnor5.0
RGSC_v3.4	7	131,779,539 - 131,779,682	RGD	RGSC3.4
RGSC_v3.4	7	131,779,540 - 131,779,682	UniSTS	RGSC3.4
RGSC_v3.1	7	131,855,977 - 131,856,119	RGD
Celera	7	120,851,118 - 120,851,253	UniSTS
RH 3.4 Map	7	1022.4	RGD
RH 3.4 Map	7	1022.4	UniSTS
RH 2.0 Map	7	753.5	RGD
Cytogenetic Map	7	q35	UniSTS

RH143357

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	126,325,254 - 126,325,976 (+)	Marker Load Pipeline
mRatBN7.2	7	124,445,802 - 124,446,524 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	134,507,003 - 134,507,724	NCBI	Rnor6.0
Rnor_5.0	7	134,177,213 - 134,177,934	UniSTS	Rnor5.0
RGSC_v3.4	7	131,772,302 - 131,773,023	UniSTS	RGSC3.4
Celera	7	120,843,883 - 120,844,604	UniSTS
RH 3.4 Map	7	1008.8	UniSTS
Cytogenetic Map	7	q35	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001134871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079923	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264281	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264282	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235202	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006621 ⟹ ENSRNOP00000006621

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	124,444,152 - 124,499,928 (-)	Ensembl
Rnor_6.0 Ensembl	7	134,505,737 - 134,560,713 (-)	Ensembl

RefSeq Acc Id:

NM_001134871 ⟹ NP_001128343

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	126,323,604 - 126,378,784 (-)	NCBI
mRatBN7.2	7	124,444,152 - 124,499,336 (-)	NCBI
Rnor_6.0	7	134,505,352 - 134,560,713 (-)	NCBI
Rnor_5.0	7	134,175,947 - 134,230,702 (-)	NCBI
RGSC_v3.4	7	131,771,036 - 131,825,986 (-)	RGD
Celera	7	120,842,232 - 120,897,579 (-)	NCBI

Sequence:

show sequence

GCGGCGGCGGCGGCGGCTGCAGCTCGCGGCGCGGCCTTCCCCGCCCCCTCGCCTCCGCGCTTCCGCCGGCCCCTCGCCTCGGCGCTGACAGACGGGCCGCGGCCTCGCGCGCGTCGGCAGCGAGCATG
GGCGACAAGAAGAGCCCCACCAGGCCGAAGCGGCAGCCGAAGCCCGCCTCGGATGAGGGCTACTGGGACTGCAGCGTCTGCACCTTCCGGAACAGCGCCGAGGCCTTCAAGTGCATGATGTGCGATGT
GCGGAAGGGCACCTCCACCCGGAAACCTCGCCCTGTCTCCCAGCTGGTCGCACAGCAGGTCACTCAGCAGTTCGTGCCCCCTACCCAGTCGAAGAAAGAGAAGAAAGACAAAGTAGAGAAGGACAAAA
GTGAGAAGGAAGCAGCTAGCAAAAAGAACTGTCACAAGAGAACCAGACCAAGATTAAAAAATGTGGATCGGAGTAGCGCGCAGCACTTGGAAGTCACTGTTGGAGACCTGACAGTCATTATCACAGAC
TTTAAGGAGAAAGCGAAGTCAGCGCCTGCATCCGGAGCCGCGGCCGCCGATCAGCACAGCCAGAGCAGCTGCAGCTCGGACACCACCGAGCGGGGCCTGTCCAGGTCCTCCTCGCCCCGCGGAGAAGC
CTCGTCCCTGAACGGAGAGTCGCACTAAACACTCGAGCTCCACTTAGTCATGCCTGTCCTCCATGGAAACACAGATTATGCCAACAACTACCACATTTTCATGACAGACACTCATGCATAACCTATAA
TTTGAGTTTTACATGAAACATGAATTTGCCAGGATTCATTAGATTTATTGCAGTGTAAGCTACCGAACATTTCCAGACGTAACATTTCGGTCTCTGCTGTGAAAGGCCATGAAAATGTGGTTGAATTA
TTCATTATGCAGTGTTATTGGTAAGTCTATTTTCACTTATAGTTTAGTGAATTCTAACACATAATTATTGAATTCTCTACTATTGGCATGTAATGAGTTTAAATTTTTTATTACATAGTGCAAGCTGC
CTAAATATGTATTATTTGAGAATTGTGAAACAAATAGTTATATGTATGCAAGTCAGAGGTCGGCTGAATTACTCTTGCTGCGACAGGACTTTCTTAATGCCTATTCTCCTAATGCACCTGCTGGTACT
TGGTGTGATTAAATAGGAAAGTTGTTATTAAATAAAGAATTTGTATGAACCTTTGCCAATGTTTTTGACATGTTTTTACTAAATTATTGTTTCTGAGTTATGTTTTATCCATTTTTGCAGTTTATGTT
TGTTAGTTTGCTTGTTTTTCAAAGCCTCGGTTTGTTGTACTGTTTACTAGCTGAATAGTAAACAATAAAACACGGACTGTGTAGCTTTCTGATTGAACACTGGTATTTCCTGTATTCTCTAAGACGTT
AAAGTTGAAGGAGTATACGTATCTGGCAGGAACAGGAAAGAACTGCCATCCTTGCAAAAGCTTTAACTTAATGATAGTTTATCACTGTTTCCTTGTTCCAAACCTGTCCCGGGTCATAGACATGTGAA
TCTAATTAATATAACGTGTAACTATTGCACAGTACTGGGGTGCACTCCTAAGGTGATTTAATTGGCCTTTTCCTAAATATAACAATTGGTCTGGAAACCATAGTACTCTGGGTTCCAGATACAGCCTC
CAGTTTATGCACTTATCAATATCCTGAAATAGAAAGTATTTACAGCCCCACTCACTTATGTATAATTACCAATAAAATATTTTTTATGACTTAAGATTTTGCATTTTGTTTACAACTAAATGGAGTGT
GTTATGTTGTATTTGAAAATCCATCTTAGAAACTATATGCTATATCTTAAATTCTCAGGTTCTCTTGTTTTCTCTAGCCATTTGCTTAATATATATCTGCCCATGGGGGAGTCTCTGAAATGTAAATT
AAACTAAAGACAAGAACCTTACTTGAATATCACCTGTCACGTAAAAGACATCATGGTAACATTTGAAGGTAAAGCTGTGGCCCCTAACGGTTGTGATACTGGTTTCCATGGTAATGTAACTGTTGAAA
TACAGTACGCTCATTGGCACAGTGGCACTCTTATGACGTGCTAGTTGTGAATCCAGTTTCTTGGTTACAGTAAAAGTCTGTGATGAAAACATTCA

hide sequence

RefSeq Acc Id:

XM_039079923 ⟹ XP_038935851

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	126,323,989 - 126,336,616 (-)	NCBI
mRatBN7.2	7	124,444,537 - 124,456,451 (-)	NCBI

RefSeq Acc Id:

XM_063264281 ⟹ XP_063120351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	126,359,118 - 126,379,061 (-)	NCBI

RefSeq Acc Id:

XM_063264282 ⟹ XP_063120352

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	126,323,989 - 126,378,838 (-)	NCBI


Protein RefSeqs	NP_001128343	(Get FASTA)	NCBI Sequence Viewer
	XP_038935851	(Get FASTA)	NCBI Sequence Viewer
	XP_063120351	(Get FASTA)	NCBI Sequence Viewer
	XP_063120352	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL76622	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006621.7

RefSeq Acc Id:	NP_001128343 ⟸ NM_001134871
- UniProtKB:	A6K7S8 (UniProtKB/TrEMBL), A6K7S7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGDKKSPTRPKRQPKPASDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKDKSEKEAASKKNCHKRTRPRLKNVDRSSAQHLEVTVGDLTVIIT DFKEKAKSAPASGAAAADQHSQSSCSSDTTERGLSRSSSPRGEASSLNGESH hide sequence

Ensembl Acc Id:

ENSRNOP00000006621 ⟸ ENSRNOT00000006621

RefSeq Acc Id:	XP_038935851 ⟸ XM_039079923
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063120352 ⟸ XM_063264282
- Peptide Label:	isoform X3
- UniProtKB:	A6K7S7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063120351 ⟸ XM_063264281
- Peptide Label:	isoform X1

Protein Domains

RanBP2-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZII7-F1-model_v2	AlphaFold	D3ZII7	1-179	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13695601

Promoter ID:

EPDNEW_R6126

Type:

multiple initiation site

Name:

Yaf2_1

Description:

YY1 associated factor 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	134,560,624 - 134,560,684	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-32339	BioCyc
Ensembl Genes	ENSRNOG00000004773	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006621.7	UniProtKB/TrEMBL
Gene3D-CATH	Zinc finger, RanBP2-type	UniProtKB/TrEMBL
InterPro	RYBP/YAF2	UniProtKB/TrEMBL
	YAF2_RYBP	UniProtKB/TrEMBL
	Znf_RanBP2	UniProtKB/TrEMBL
	Znf_RanBP2_sf	UniProtKB/TrEMBL
KEGG Report	rno:690262	UniProtKB/TrEMBL
NCBI Gene	690262	ENTREZGENE
PANTHER	PTHR12920	UniProtKB/TrEMBL
	PTHR12920:SF2	UniProtKB/TrEMBL
Pfam	YAF2_RYBP	UniProtKB/TrEMBL
	zf-RanBP	UniProtKB/TrEMBL
PhenoGen	Yaf2	PhenoGen
PROSITE	ZF_RANBP2_1	UniProtKB/TrEMBL
	ZF_RANBP2_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004773	RatGTEx
SMART	ZnF_RBZ	UniProtKB/TrEMBL
Superfamily-SCOP	SSF90209	UniProtKB/TrEMBL
UniProt	A6K7S7	ENTREZGENE, UniProtKB/TrEMBL
	A6K7S8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZII7_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Yaf2	YY1 associated factor 2	LOC690262	similar to YY1-associated factor 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC690262	similar to YY1-associated factor 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar