Symbol:
Prr7
Name:
proline rich 7 (synaptic)
RGD ID:
1561898
Description:
Predicted to enable long-chain fatty acid binding activity; protein tyrosine kinase binding activity; and ubiquitin-like protein ligase binding activity. Involved in postsynapse to nucleus signaling pathway and regulation of transcription by RNA polymerase I. Located in neuron projection; nucleus; and postsynaptic density. Is active in glutamatergic synapse and postsynaptic density, intracellular component. Orthologous to human PRR7 (proline rich 7, synaptic); INTERACTS WITH 1,2-dimethylhydrazine; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
proline rich 7; proline-rich protein 7; synaptic proline-rich membrane protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRR7 (proline rich 7, synaptic) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Prr7 (proline rich 7 (synaptic)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prr7 (proline rich 7, synaptic) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRR7 (proline rich 7, synaptic) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRR7 (proline rich 7, synaptic) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prr7 (proline rich 7, synaptic) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRR7 (proline rich 7, synaptic) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRR7 (proline rich 7, synaptic) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prr7 (proline rich 7, synaptic) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PRR7 (proline rich 7, synaptic)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prr7 (proline rich 7 (synaptic))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prr7
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 9,170,405 - 9,178,814 (-) NCBI GRCr8 mRatBN7.2 17 9,164,375 - 9,173,669 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 9,165,269 - 9,172,536 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 9,181,390 - 9,182,514 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 10,711,423 - 10,712,547 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 9,177,778 - 9,178,902 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 9,693,274 - 9,702,795 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 9,694,168 - 9,695,292 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 11,803,146 - 11,811,418 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 15,209,243 - 15,210,367 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 17 9,243,777 - 9,244,901 (-) NCBI Celera Cytogenetic Map 17 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prr7 Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1,2-Dimethylhydrazine] which results in increased expression of PRR7 mRNA CTD PMID:27840820 Prr7 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PRR7 mRNA CTD PMID:32741896 Prr7 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PRR7 mRNA CTD PMID:32741896 Prr7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1614729 6480464 Tetrachlorodibenzodioxin affects the expression of PRR7 mRNA CTD PMID:21570461 Prr7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PRR7 mRNA CTD PMID:33387578 Prr7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRR7 mRNA CTD PMID:34747641 Prr7 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1345236 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Prr7 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1614729 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of PRR7 mRNA CTD PMID:30951980 Prr7 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Prr7 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1614729 6480464 bisphenol S affects the methylation of PRR7 gene CTD PMID:31683443 Prr7 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PRR7 mRNA CTD PMID:24780913|PMID:30047161 Prr7 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PRR7 mRNA CTD PMID:31881176 Prr7 Rat aflatoxin B1 increases expression ISO RGD:1345236 6480464 Aflatoxin B1 results in increased expression of PRR7 mRNA CTD PMID:22100608 Prr7 Rat all-trans-retinoic acid decreases expression ISO RGD:1345236 6480464 Tretinoin results in decreased expression of PRR7 mRNA CTD PMID:23830798 Prr7 Rat all-trans-retinoic acid multiple interactions ISO RGD:1614729 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of PRR7 mRNA CTD PMID:30951980 Prr7 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PRR7 mRNA CTD PMID:35163327 Prr7 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PRR7 mRNA CTD PMID:30047161 Prr7 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PRR7 mRNA CTD PMID:30779732 Prr7 Rat aristolochic acid A decreases expression ISO RGD:1345236 6480464 aristolochic acid I results in decreased expression of PRR7 mRNA CTD PMID:33212167 Prr7 Rat atrazine increases expression ISO RGD:1345236 6480464 Atrazine results in increased expression of PRR7 mRNA CTD PMID:22378314 Prr7 Rat azoxystrobin decreases expression ISO RGD:1345236 6480464 azoxystrobin results in decreased expression of PRR7 mRNA CTD PMID:33512557 Prr7 Rat benzo[a]pyrene decreases expression ISO RGD:1614729 6480464 Benzo(a)pyrene results in decreased expression of PRR7 mRNA CTD PMID:27195522 Prr7 Rat benzo[a]pyrene increases methylation ISO RGD:1345236 6480464 Benzo(a)pyrene results in increased methylation of PRR7 promoter CTD PMID:27901495 Prr7 Rat benzo[a]pyrene multiple interactions ISO RGD:1614729 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Prr7 Rat benzo[a]pyrene increases expression ISO RGD:1345236 6480464 Benzo(a)pyrene results in increased expression of PRR7 mRNA CTD PMID:20064835|PMID:21632981|PMID:26238291|PMID:32234424 Prr7 Rat benzo[b]fluoranthene multiple interactions ISO RGD:1614729 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Prr7 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PRR7 mRNA CTD PMID:25181051 Prr7 Rat bisphenol A increases expression ISO RGD:1614729 6480464 bisphenol A results in increased expression of PRR7 mRNA CTD PMID:32156529 Prr7 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Prr7 Rat bisphenol A multiple interactions ISO RGD:1345236 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Prr7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRR7 mRNA CTD PMID:30816183|PMID:34947998 Prr7 Rat bisphenol F decreases expression ISO RGD:1614729 6480464 bisphenol F results in decreased expression of PRR7 mRNA CTD PMID:38685157 Prr7 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Prr7 Rat bortezomib decreases expression ISO RGD:1345236 6480464 Bortezomib results in decreased expression of PRR7 mRNA CTD PMID:20977926 Prr7 Rat butan-1-ol multiple interactions ISO RGD:1345236 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Prr7 Rat cadmium atom increases expression ISO RGD:1345236 6480464 Cadmium results in increased expression of PRR7 mRNA CTD PMID:24376830 Prr7 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of PRR7 promoter CTD PMID:22457795 Prr7 Rat cadmium dichloride decreases expression ISO RGD:1345236 6480464 Cadmium Chloride results in decreased expression of PRR7 mRNA CTD PMID:38568856 Prr7 Rat carbon nanotube increases expression ISO RGD:1614729 6480464 Nanotubes, Carbon analog results in increased expression of PRR7 mRNA CTD PMID:25554681 Prr7 Rat chlorpyrifos increases expression ISO RGD:1614729 6480464 Chlorpyrifos results in increased expression of PRR7 mRNA CTD PMID:37019170 Prr7 Rat chrysene multiple interactions ISO RGD:1614729 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Prr7 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PRR7 mRNA CTD PMID:26577399 Prr7 Rat cyclosporin A decreases expression ISO RGD:1345236 6480464 Cyclosporine results in decreased expression of PRR7 mRNA CTD PMID:27989131 Prr7 Rat DDE increases expression ISO RGD:1345236 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of PRR7 mRNA CTD PMID:38568856 Prr7 Rat deguelin decreases expression ISO RGD:1345236 6480464 deguelin results in decreased expression of PRR7 mRNA CTD PMID:33512557 Prr7 Rat dexamethasone multiple interactions ISO RGD:1345236 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Prr7 Rat dibutyl phthalate affects expression EXP 6480464 Dibutyl Phthalate affects the expression of PRR7 mRNA CTD PMID:24893172 Prr7 Rat hydrogen peroxide affects expression ISO RGD:1345236 6480464 Hydrogen Peroxide affects the expression of PRR7 mRNA CTD PMID:20044591 Prr7 Rat indometacin multiple interactions ISO RGD:1345236 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Prr7 Rat lipopolysaccharide decreases expression ISO RGD:1345236 6480464 Lipopolysaccharides results in decreased expression of PRR7 mRNA CTD PMID:35811015 Prr7 Rat lipopolysaccharide multiple interactions ISO RGD:1345236 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PRR7 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Prr7 Rat maneb multiple interactions ISO RGD:1614729 6480464 [Paraquat co-treated with Maneb] affects the expression of PRR7 mRNA CTD PMID:22563483 Prr7 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PRR7 mRNA CTD PMID:30047161 Prr7 Rat N-Nitrosopyrrolidine increases expression ISO RGD:1345236 6480464 N-Nitrosopyrrolidine results in increased expression of PRR7 mRNA CTD PMID:32234424 Prr7 Rat O-methyleugenol increases expression ISO RGD:1345236 6480464 methyleugenol results in increased expression of PRR7 mRNA CTD PMID:32234424 Prr7 Rat okadaic acid increases expression ISO RGD:1345236 6480464 Okadaic Acid results in increased expression of PRR7 mRNA CTD PMID:38832940 Prr7 Rat ozone multiple interactions ISO RGD:1345236 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of PRR7 mRNA CTD PMID:35430440 Prr7 Rat paraquat multiple interactions ISO RGD:1614729 6480464 [Paraquat co-treated with Maneb] affects the expression of PRR7 mRNA CTD PMID:22563483 Prr7 Rat paraquat decreases expression ISO RGD:1614729 6480464 Paraquat results in decreased expression of PRR7 mRNA CTD PMID:22563483 Prr7 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PRR7 mRNA CTD PMID:35163327 Prr7 Rat picoxystrobin decreases expression ISO RGD:1345236 6480464 picoxystrobin results in decreased expression of PRR7 mRNA CTD PMID:33512557 Prr7 Rat pyridaben decreases expression ISO RGD:1614729 6480464 pyridaben results in decreased expression of PRR7 mRNA CTD PMID:22563483 Prr7 Rat quercetin increases expression ISO RGD:1345236 6480464 Quercetin results in increased expression of PRR7 mRNA CTD PMID:21632981 Prr7 Rat resveratrol multiple interactions ISO RGD:1345236 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of PRR7 mRNA CTD PMID:23557933 Prr7 Rat rotenone decreases expression ISO RGD:1345236 6480464 Rotenone results in decreased expression of PRR7 mRNA CTD PMID:33512557 Prr7 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1345236 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PRR7 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Prr7 Rat sodium arsenite decreases expression ISO RGD:1345236 6480464 sodium arsenite results in decreased expression of PRR7 mRNA CTD PMID:38568856 Prr7 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PRR7 mRNA CTD PMID:32741896 Prr7 Rat tetraphene multiple interactions ISO RGD:1614729 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Prr7 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PRR7 mRNA CTD PMID:34492290 Prr7 Rat thiram decreases expression ISO RGD:1345236 6480464 Thiram results in decreased expression of PRR7 mRNA CTD PMID:38568856 Prr7 Rat titanium dioxide increases methylation ISO RGD:1614729 6480464 titanium dioxide results in increased methylation of PRR7 gene CTD PMID:35295148 Prr7 Rat titanium dioxide decreases methylation ISO RGD:1614729 6480464 titanium dioxide results in decreased methylation of PRR7 gene CTD PMID:35295148 Prr7 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PRR7 mRNA CTD PMID:33387578 Prr7 Rat triphenyl phosphate affects expression ISO RGD:1345236 6480464 triphenyl phosphate affects the expression of PRR7 mRNA CTD PMID:37042841 Prr7 Rat trovafloxacin increases expression ISO RGD:1614729 6480464 trovafloxacin results in increased expression of PRR7 mRNA CTD PMID:35537566 Prr7 Rat urethane decreases expression ISO RGD:1345236 6480464 Urethane results in decreased expression of PRR7 mRNA CTD PMID:28818685
1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) amphetamine (EXP) aristolochic acid A (ISO) atrazine (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) bortezomib (ISO) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) chlorpyrifos (ISO) chrysene (ISO) Cuprizon (EXP) cyclosporin A (ISO) DDE (ISO) deguelin (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) hydrogen peroxide (ISO) indometacin (ISO) lipopolysaccharide (ISO) maneb (ISO) methimazole (EXP) N-Nitrosopyrrolidine (ISO) O-methyleugenol (ISO) okadaic acid (ISO) ozone (ISO) paraquat (ISO) perfluorooctanoic acid (EXP) picoxystrobin (ISO) pyridaben (ISO) quercetin (ISO) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) testosterone (EXP) tetraphene (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) trovafloxacin (ISO) urethane (ISO)
Cellular Component
cell projection (IEA) cytoplasm (IEA) cytosol (IEA,ISO) dendrite (IEA) glutamatergic synapse (IDA,IEP,IMP) membrane (IEA) neuron projection (IDA) nucleoplasm (IEA,ISO) nucleus (IBA,IDA,IEA) perinuclear region of cytoplasm (IEA,ISO,ISS) plasma membrane (IEA,ISO,ISS) postsynaptic density (IDA) postsynaptic density membrane (IEA) postsynaptic density, intracellular component (IBA,IDA,IEP,IMP) postsynaptic membrane (IEA) synapse (IDA,IEA)
Prr7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 9,170,405 - 9,178,814 (-) NCBI GRCr8 mRatBN7.2 17 9,164,375 - 9,173,669 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 9,165,269 - 9,172,536 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 9,181,390 - 9,182,514 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 10,711,423 - 10,712,547 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 9,177,778 - 9,178,902 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 9,693,274 - 9,702,795 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 9,694,168 - 9,695,292 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 11,803,146 - 11,811,418 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 15,209,243 - 15,210,367 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 17 9,243,777 - 9,244,901 (-) NCBI Celera Cytogenetic Map 17 p14 NCBI
PRR7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 177,445,995 - 177,456,286 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 177,446,445 - 177,456,286 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 176,872,996 - 176,883,287 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 176,806,400 - 176,815,889 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 176,806,401 - 176,815,889 NCBI Celera 5 171,618,357 - 171,627,632 (-) NCBI Celera Cytogenetic Map 5 q35.3 NCBI HuRef 5 171,794,261 - 171,803,535 (+) NCBI HuRef CHM1_1 5 176,307,202 - 176,316,315 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 177,989,257 - 177,999,332 (+) NCBI T2T-CHM13v2.0
Prr7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 55,612,080 - 55,620,968 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 55,612,080 - 55,620,967 (+) Ensembl GRCm39 Ensembl GRCm38 13 55,464,267 - 55,473,162 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 55,464,267 - 55,473,154 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 55,565,628 - 55,574,516 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 55,481,647 - 55,482,774 (+) NCBI MGSCv36 mm8 Celera 13 56,518,298 - 56,527,198 (+) NCBI Celera Cytogenetic Map 13 B1 NCBI cM Map 13 30.06 NCBI
Prr7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 29,692,004 - 29,695,113 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 29,685,254 - 29,695,113 (+) NCBI ChiLan1.0 ChiLan1.0
PRR7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 172,530,012 - 172,540,600 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 170,669,548 - 170,680,144 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 172,748,020 - 172,757,989 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 179,818,184 - 179,820,471 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 179,818,184 - 179,821,479 (+) Ensembl panpan1.1 panPan2
PRR7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 35,913,300 - 35,923,823 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 35,913,472 - 35,943,221 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 35,880,991 - 35,882,194 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 36,280,009 - 36,281,212 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 36,280,090 - 36,281,075 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 36,105,275 - 36,106,470 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 36,291,229 - 36,292,426 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 36,800,703 - 36,801,904 (-) NCBI UU_Cfam_GSD_1.0
Prr7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 122,701,213 - 122,710,382 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936597 1,726,070 - 1,735,343 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936597 1,726,143 - 1,735,295 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRR7
PRR7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 79,458,347 - 79,467,421 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 79,466,186 - 79,467,257 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666075 10,650,015 - 10,659,071 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prr7
.
Predicted Target Of
Count of predictions: 69 Count of miRNA genes: 61 Interacting mature miRNAs: 68 Transcripts: ENSRNOT00000036162 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 631499 Stl1 Serum triglyceride level QTL 1 3.6 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 3271398 27389946 Rat 2293664 Bmd28 Bone mineral density QTL 28 5.1 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 17 4354487 27028127 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 2324619 Coatc4 Coat color QTL 4 0.001 coat/hair pigmentation trait (VT:0010463) pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811) 17 4299130 21293263 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 1581553 Pur14 Proteinuria QTL 14 5.3 0.0001 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 17 7979968 16317111 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 2293648 Bmd31 Bone mineral density QTL 31 4.5 0.0001 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 17 4354487 27028127 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 1641902 Colcr7 Colorectal carcinoma resistance QTL 7 3.35 0.0044 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 17 2115149 21881669 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 9590316 Scort21 Serum corticosterone level QTL 21 4.75 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 1 22871563 Rat
D17Rat106
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 17 9,180,366 - 9,180,510 (+) Marker Load Pipeline mRatBN7.2 17 9,175,224 - 9,175,368 (+) MAPPER mRatBN7.2 Rnor_6.0 17 9,704,124 - 9,704,267 NCBI Rnor6.0 Rnor_5.0 17 11,813,108 - 11,813,251 UniSTS Rnor5.0 RGSC_v3.4 17 15,219,198 - 15,219,342 RGD RGSC3.4 RGSC_v3.4 17 15,219,199 - 15,219,342 UniSTS RGSC3.4 RGSC_v3.1 17 15,219,199 - 15,219,342 RGD Celera 17 9,253,733 - 9,253,877 UniSTS RH 3.4 Map 17 79.2 UniSTS RH 3.4 Map 17 79.2 RGD RH 2.0 Map 17 42.9 RGD SHRSP x BN Map 17 8.3 RGD Cytogenetic Map 17 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
113
90
89
58
25
58
6
216
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000036162 ⟹ ENSRNOP00000038274
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 9,165,269 - 9,172,536 (-) Ensembl Rnor_6.0 Ensembl 17 9,694,168 - 9,695,292 (-) Ensembl
RefSeq Acc Id:
NM_001109116 ⟹ NP_001102586
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 9,170,411 - 9,171,535 (-) NCBI mRatBN7.2 17 9,165,269 - 9,166,393 (-) NCBI Rnor_6.0 17 9,694,168 - 9,695,292 (-) NCBI Rnor_5.0 17 11,803,146 - 11,811,418 (-) NCBI RGSC_v3.4 17 15,209,243 - 15,210,367 (-) RGD Celera 17 9,243,777 - 9,244,901 (-) RGD
Sequence:
ATGGTGATGTCCCAGGGCACCTACACGTTCCTCACGTGCTTCGCCGGCTTCTGGCTCATCTGGGGTCTCATCGTCCTGCTCTGCTGCTTCTGCAGCTTCCTGCGCCGCCGCCTCAAACGGCGCCAGGA
hide sequence
RefSeq Acc Id:
XM_006253652 ⟹ XP_006253714
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 9,170,405 - 9,178,814 (-) NCBI mRatBN7.2 17 9,164,375 - 9,173,669 (-) NCBI Rnor_6.0 17 9,693,274 - 9,702,518 (-) NCBI Rnor_5.0 17 11,803,146 - 11,811,418 (-) NCBI
Sequence:
CCGCTGCCTTCTCCAAGCTTGGGGTTCTGTCCGCTGGGCCGCTTGCCCCGAGGCAGGAAGACGAGTTCGAGGAGGATGCCTGGGCCCGTCGCTCGCGGCCCCGGGTGAAGCAGGCCCGCGCCGGCCGG
hide sequence
RefSeq Acc Id:
XM_063276687 ⟹ XP_063132757
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 9,170,405 - 9,178,386 (-) NCBI
RefSeq Acc Id:
NP_001102586 ⟸ NM_001109116
- UniProtKB:
P0C6T3 (UniProtKB/Swiss-Prot), A6KAS6 (UniProtKB/TrEMBL)
- Sequence:
MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPPPPHRSRLEAPVHAHSHVHVHPLLHHGPAQPHAHPHPHHHALPHPPPSHLSVP
hide sequence
RefSeq Acc Id:
XP_006253714 ⟸ XM_006253652
- Peptide Label:
isoform X1
- UniProtKB:
P0C6T3 (UniProtKB/Swiss-Prot), A6KAS6 (UniProtKB/TrEMBL)
- Sequence:
MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGS
hide sequence
Ensembl Acc Id:
ENSRNOP00000038274 ⟸ ENSRNOT00000036162
RefSeq Acc Id:
XP_063132757 ⟸ XM_063276687
- Peptide Label:
isoform X1
- UniProtKB:
P0C6T3 (UniProtKB/Swiss-Prot), A6KAS6 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Prr7
proline rich 7 (synaptic)
Prr7
proline rich 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
Prr7
proline rich 7
Symbol and Name status set to provisional
70820 PROVISIONAL
