Advanced Search (OLGA)

Gene: Ct55 (cancer/testis antigen 55) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ct55

Name:

cancer/testis antigen 55

RGD ID:

1560456

Description:

Predicted to be involved in spermatogenesis. Predicted to be located in acrosomal vesicle and sperm flagellum. Human ortholog(s) of this gene implicated in X-linked spermatogenic failure 7. Orthologous to human CT55 (cancer/testis antigen 55); INTERACTS WITH aflatoxin B1 (ortholog); benzo[a]pyrene (ortholog); bisphenol A (ortholog).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC317310; RGD1560456; similar to chromosome X open reading frame 48

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	138,525,325 - 138,538,521 (+)	NCBI		GRCr8
mRatBN7.2	X	133,502,545 - 133,515,730 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	133,502,869 - 133,515,529 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	X	73,512,835 - 73,525,680 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	73,513,028 - 73,525,650 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	74,325,549 - 74,346,126 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	141,029,710 - 141,042,620 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	X	68,801,015 - 68,813,750 (-)	NCBI		Celera
Cytogenetic Map	X	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ct55	Rat	autistic disorder		ISO	CT55 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
Ct55	Rat	autosomal hemophilia A		ISO	CT55 (Homo sapiens)	8554872	ClinVar Annotator: match by term: AUTOSOMAL HEMOPHILIA A	ClinVar	PMID:31690835
Ct55	Rat	factor VIII deficiency		ISO	CT55 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Factor 8 deficiency and congenital	ClinVar	PMID:31690835
Ct55	Rat	syndromic X-linked intellectual disability Lubs type		ISO	CT55 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Syndromic X-linked intellectual disability Lubs type	ClinVar	PMID:25741868
Ct55	Rat	X-linked spermatogenic failure 7		ISO	CT55 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Spermatogenic failure more ...	ClinVar	PMID:36481789

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ct55	Rat	X-linked spermatogenic failure 7		ISO	CT55 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ct55	Rat	aflatoxin B1	increases methylation	ISO	CT55 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of CT55 5' UTR and Aflatoxin B1 results in increased methylation of CT55 intron	CTD	PMID:30157460
Ct55	Rat	benzo[a]pyrene	increases methylation	ISO	CT55 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of CT55 5' UTR and Benzo(a)pyrene results in increased methylation of CT55 promoter	CTD	PMID:27901495
Ct55	Rat	bisphenol A	increases expression	ISO	Ct55 (Mus musculus)	6480464	bisphenol A results in increased expression of CT55 mRNA	CTD	PMID:32156529
Ct55	Rat	paracetamol	decreases expression	ISO	CT55 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of CT55 mRNA	CTD	PMID:29067470
Ct55	Rat	resveratrol	multiple interactions	ISO	CT55 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of CT55 mRNA	CTD	PMID:23557933

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ct55	Rat	spermatogenesis	involved_in	ISO	CT55 (Homo sapiens)	1624291	PMID:36481789	RGD	PMID:36481789
Ct55	Rat	spermatogenesis	involved_in	ISO	Ct55 (Mus musculus)	1624291	PMID:36481789	RGD	PMID:36481789

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ct55	Rat	acrosomal vesicle	located_in	ISO	CT55 (Homo sapiens)	1624291	PMID:36481789	RGD	PMID:36481789
Ct55	Rat	acrosomal vesicle	located_in	ISO	Ct55 (Mus musculus)	1624291	PMID:36481789	RGD	PMID:36481789
Ct55	Rat	cytoplasm	located_in	ISO	CT55 (Homo sapiens)	1624291	PMID:36481789	RGD	PMID:36481789
Ct55	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ct55	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ct55	Rat	cytoplasm	located_in	ISO	Ct55 (Mus musculus)	1624291	PMID:36481789	RGD	PMID:36481789
Ct55	Rat	sperm flagellum	located_in	ISO	CT55 (Homo sapiens)	1624291	PMID:36481789	RGD	PMID:36481789
Ct55	Rat	sperm flagellum	located_in	ISO	Ct55 (Mus musculus)	1624291	PMID:36481789	RGD	PMID:36481789

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ct55	Rat	protein binding	enables	ISO	CT55 (Homo sapiens)	1624291	UniProtKB:O95166 more ...	RGD	PMID:25416956 more ...

Ct55
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	138,525,325 - 138,538,521 (+)	NCBI		GRCr8
mRatBN7.2	X	133,502,545 - 133,515,730 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	133,502,869 - 133,515,529 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	X	73,512,835 - 73,525,680 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	73,513,028 - 73,525,650 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	74,325,549 - 74,346,126 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	141,029,710 - 141,042,620 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	X	68,801,015 - 68,813,750 (-)	NCBI		Celera
Cytogenetic Map	X	q36	NCBI

CT55
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	135,156,536 - 135,171,827 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	135,156,540 - 135,171,398 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	134,290,461 - 134,305,751 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	134,118,127 - 134,133,417 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	134,015,982 - 134,031,271	NCBI
Celera	X	134,675,809 - 134,689,429 (-)	NCBI		Celera
Cytogenetic Map	X	q26.3	NCBI
HuRef	X	123,693,013 - 123,709,275 (+)	NCBI		HuRef
CHM1_1	X	134,201,434 - 134,216,743 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	133,482,335 - 133,497,625 (-)	NCBI		T2T-CHM13v2.0

Ct55
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	52,726,622 - 52,740,532 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	52,718,510 - 52,740,410 (+)	Ensembl		GRCm39 Ensembl
GRCm38	X	53,724,655 - 53,738,565 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	53,724,826 - 53,738,441 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	51,028,008 - 51,041,399 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	49,919,453 - 49,933,068 (+)	NCBI		MGSCv36	mm8
Celera	X	41,050,931 - 41,064,534 (+)	NCBI		Celera
Cytogenetic Map	X	A5	NCBI
cM Map	X	29.99	NCBI

Ct55
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004956648	483 - 703 (-)	NCBI	ChiLan1.0	ChiLan1.0

CT55
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	105,741,570 - 105,753,979 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	91,747,994 - 91,760,405 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	107,502,010 - 107,514,423 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	X	104,908,030 - 104,920,439 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	106,776,999 - 106,789,412 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	106,936,145 - 106,948,552 (-)	NCBI		UU_Cfam_GSD_1.0

Ct55
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	104,127,784 - 104,141,020 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936513	11,473,810 - 11,496,812 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CT55
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	X	110,848,227 - 110,890,277 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	126,871,316 - 126,901,050 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants in Ct55
25 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	56
Count of miRNA genes:	54
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000031815
Prediction methods:	Microtar, Miranda, Pita, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598872	Memor14	Memory QTL 14	4.5		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	93956491	138956491	Rat
1598856	Memor1	Memory QTL 1	1.9		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	X	103312877	148312877	Rat
1598809	Memor15	Memory QTL 15	4.4		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	103312877	148312877	Rat
738025	Stresp3	Stress response QTL 3	4.61	0.0066	stress-related behavior trait (VT:0010451)	defensive burying - approach	X	100567703	150256146	Rat
634346	Insul4	Insulin level QTL 4	0		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	X	126975089	152453651	Rat
738029	Stresp2	Stress response QTL 2	3.4	0.0004	stress-related behavior trait (VT:0010451)	defensive burying - approach	X	112934952	138400867	Rat
10059603	Bw174	Body weight QTL 174	3.4	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	X	113937816	152453651	Rat
1598837	Memor13	Memory QTL 13	3.2		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	41052407	146860749	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
2	1	55	17	14	7	1	7	23	5	51	8	49	7


RefSeq Transcripts	NM_001433344	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_001053997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_228664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000031815

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	133,502,869 - 133,515,529 (+)	Ensembl
Rnor_6.0 Ensembl	X	73,513,028 - 73,525,650 (-)	Ensembl

RefSeq Acc Id:

XM_228664 ⟹ XP_228664

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	138,525,325 - 138,538,521 (+)	NCBI
mRatBN7.2	X	133,502,545 - 133,515,730 (+)	NCBI
Rnor_6.0	X	73,512,835 - 73,525,680 (-)	NCBI
Rnor_5.0	X	74,325,549 - 74,346,126 (-)	NCBI
RGSC_v3.4	X	141,029,710 - 141,042,620 (-)	RGD

Sequence:

show sequence

CCTGTGGGAGTCTTAGACTAGAGAGGCTGTACAGAGGACACGGAAGTAGAGTTGTGTCTGTGAGAGTTGCTGTGATTAGGGCTCTCCTGGGAGACAGAGAACTAGAGAGAAGGAAGCCTTAGTCCTGG
TACCACCTGGTGCCGAAGCCTGCTCAGACAACGAACTATGCACCGGCTAATTTCCAGATTTCGTGCCATCTTTCAAAGGAAAGCGGACCTGAAGGAGGCGAGGGAAGAGCAGCAGAGGCTCTTGGAAG
ATGATACCATATTACAATACAAACATCAAGTTATGGCAGGGTCCTGTACTAACTATGACTGGATCCACTTCAGTACTGACGTCATCGTGACTTGCGACAGCCCTCCGAAAGTTCAACAAAAACTTCCT
GCAGCTGCAGAAGAACAAAGCACTCACGGATTGAACTCGGTCACAGTGGATGCTCTCTCCTATGACCATGATGAACAACCAGCAGACTCTCACATGAGAGTTTTGTTTGGCTGTGTGACAGGTGACAC
TGACTACAATGATCACGGATTGTCCTTCTCTCTAGACATTGCTTGTAAAGATTTTCGGCCTTATAATGGTGACCTGGTAGAAATTGAGTTTTCTGATGAGCAAGACACACAGAACAGAAGGGCCATCT
TGGTGAAGCCTCTGAAACATTGTCATATAAATGAGGCCTGTGTTACAAAAATGGATGGAAGAACTGGGGTGTTGGAAAACGACATCTTTTTCACCTTGGATTCTCTTAAACTTCCTTCTGGATATGTG
CCGCAGGCAGGTGACGTTGTCAATGTGGTTGCAGTGCAGAGCATTCATCCCAACTATTTCTGGAGAGCAGTTGCTATGACCCCAGTACAAGTGTTGTAGGAACCAAACCTGTGTTCAATCTTCAGCGT
TACTTGTATGGGTAGTGAAGGGCCTGGTTTAATATTTAATATTTTTTCTAGTAGAACCCATCCTCCCATGTTAGAATGCCAAAGCCATACACAGTGTTGTTTGTCCTGTAGCTCTGAGCAGTGCCTGG
TGGATGGGGCAGACTGCACGTTTATACCTTCAATAAAGCTATTTCCTGA

hide sequence


Protein RefSeqs	NP_001420273	(Get FASTA)	NCBI Sequence Viewer
	XP_228664	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL85064	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000082251
	ENSRNOP00000082251.1

RefSeq Acc Id:

XP_228664 ⟸ XM_228664

- Sequence:

show sequence

MHRLISRFRAIFQRKADLKEAREEQQRLLEDDTILQYKHQVMAGSCTNYDWIHFSTDVIVTCDSPPKVQQKLPAAAEEQSTHGLNSVTVDALSYDHDEQPADSHMRVLFGCVTGDTDYNDHGLSFSLD
IACKDFRPYNGDLVEIEFSDEQDTQNRRAILVKPLKHCHINEACVTKMDGRTGVLENDIFFTLDSLKLPSGYVPQAGDVVNVVAVQSIHPNYFWRAVAMTPVQVL

hide sequence

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-958	BioCyc
Ensembl Genes	ENSRNOG00000027899	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000031815	ENTREZGENE
	ENSRNOT00000031815.3	UniProtKB/TrEMBL
KEGG Report	rno:317310	UniProtKB/TrEMBL
NCBI Gene	317310	ENTREZGENE
PANTHER	CANCER/TESTIS ANTIGEN 55	UniProtKB/TrEMBL
	CANCER/TESTIS ANTIGEN 55	UniProtKB/TrEMBL
PhenoGen	Ct55	PhenoGen
RatGTEx	ENSRNOG00000027899	RatGTEx
UniProt	A0A8I5ZUT8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-02-13	Ct55	cancer/testis antigen 55	RGD1560456	similar to chromosome X open reading frame 48	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1560456	similar to chromosome X open reading frame 48	RGD1560456_predicted	similar to chromosome X open reading frame 48 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1560456_predicted	similar to chromosome X open reading frame 48 (predicted)	LOC317310	similar to chromosome X open reading frame 48	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC317310	similar to chromosome X open reading frame 48			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM