Symbol:
Rbm6
Name:
RNA binding motif protein 6
RGD ID:
1560367
Description:
Predicted to enable RNA binding activity. Predicted to be involved in mRNA splicing, via spliceosome. Predicted to be active in nucleus. Orthologous to human RBM6 (RNA binding motif protein 6); INTERACTS WITH oxaliplatin; paracetamol; topotecan.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC315997; RGD1560367; RNA-binding protein 6; similar to Rbm6 protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 117,327,607 - 117,431,397 (-) NCBI GRCr8 mRatBN7.2 8 108,452,687 - 108,552,783 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 108,452,687 - 108,552,771 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 114,079,496 - 114,179,508 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 112,278,658 - 112,378,688 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 110,121,434 - 110,221,461 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 116,535,403 - 116,635,851 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 116,535,403 - 116,635,851 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 115,890,040 - 115,989,943 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 113,027,975 - 113,128,713 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 107,759,022 - 107,858,711 (-) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rbm6 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1558558 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RBM6 mRNA CTD PMID:36331819 Rbm6 Rat 17alpha-ethynylestradiol affects expression ISO RGD:1558558 6480464 Ethinyl Estradiol affects the expression of RBM6 mRNA CTD PMID:17555576 Rbm6 Rat 17alpha-ethynylestradiol increases expression ISO RGD:1558558 6480464 Ethinyl Estradiol results in increased expression of RBM6 mRNA CTD PMID:17942748 Rbm6 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1558558 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RBM6 mRNA CTD PMID:17942748 Rbm6 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO RGD:1342651 6480464 Metribolone results in increased expression of RBM6 mRNA CTD PMID:17010196 Rbm6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1558558 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RBM6 mRNA CTD PMID:17942748 Rbm6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1558558 6480464 Tetrachlorodibenzodioxin results in decreased expression of RBM6 mRNA CTD PMID:26290441 Rbm6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1558558 6480464 Tetrachlorodibenzodioxin affects the expression of RBM6 mRNA CTD PMID:21570461 Rbm6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1558558 6480464 Tetrachlorodibenzodioxin results in increased expression of RBM6 mRNA CTD PMID:17942748|PMID:21354282 Rbm6 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1342651 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Rbm6 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1342651 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Rbm6 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1558558 6480464 Fenretinide results in increased expression of RBM6 mRNA CTD PMID:28973697 Rbm6 Rat Aflatoxin B2 alpha decreases methylation ISO RGD:1342651 6480464 aflatoxin B2 results in decreased methylation of RBM6 intron CTD PMID:30157460 Rbm6 Rat antimycin A increases expression ISO RGD:1342651 6480464 Antimycin A results in increased expression of RBM6 mRNA CTD PMID:33512557 Rbm6 Rat aristolochic acid A decreases expression ISO RGD:1342651 6480464 aristolochic acid I results in decreased expression of RBM6 mRNA CTD PMID:33212167 Rbm6 Rat benzo[a]pyrene decreases expression ISO RGD:1558558 6480464 Benzo(a)pyrene results in decreased expression of RBM6 mRNA CTD PMID:22228805 Rbm6 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1342651 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of RBM6 mRNA CTD PMID:19150397 Rbm6 Rat beta-lapachone decreases expression ISO RGD:1342651 6480464 beta-lapachone results in decreased expression of RBM6 mRNA CTD PMID:38218311 Rbm6 Rat bisphenol A decreases expression ISO RGD:1342651 6480464 bisphenol A results in decreased expression of RBM6 mRNA CTD PMID:25047013 Rbm6 Rat cadmium dichloride decreases expression ISO RGD:1342651 6480464 Cadmium Chloride results in decreased expression of RBM6 mRNA CTD PMID:38568856 Rbm6 Rat caffeine increases phosphorylation ISO RGD:1342651 6480464 Caffeine results in increased phosphorylation of RBM6 protein CTD PMID:35688186 Rbm6 Rat captan increases expression ISO RGD:1558558 6480464 Captan results in increased expression of RBM6 mRNA CTD PMID:31558096 Rbm6 Rat carbon nanotube decreases expression ISO RGD:1558558 6480464 Nanotubes, Carbon analog results in decreased expression of RBM6 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Rbm6 Rat chlorpyrifos decreases expression ISO RGD:1558558 6480464 Chlorpyrifos results in decreased expression of RBM6 mRNA CTD PMID:37019170 Rbm6 Rat choline multiple interactions ISO RGD:1558558 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Rbm6 Rat chrysene increases expression ISO RGD:1558558 6480464 chrysene results in increased expression of RBM6 mRNA CTD PMID:26377693 Rbm6 Rat coumarin decreases phosphorylation ISO RGD:1342651 6480464 coumarin results in decreased phosphorylation of RBM6 protein CTD PMID:35688186 Rbm6 Rat cyclosporin A increases expression ISO RGD:1342651 6480464 Cyclosporine results in increased expression of RBM6 mRNA CTD PMID:25562108 Rbm6 Rat deguelin increases expression ISO RGD:1342651 6480464 deguelin results in increased expression of RBM6 mRNA CTD PMID:33512557 Rbm6 Rat dexamethasone multiple interactions ISO RGD:1342651 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Rbm6 Rat dibutyl phthalate decreases expression ISO RGD:1558558 6480464 Dibutyl Phthalate results in decreased expression of RBM6 mRNA CTD PMID:17361019|PMID:21266533 Rbm6 Rat enzyme inhibitor multiple interactions ISO RGD:1342651 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Rbm6 Rat folic acid multiple interactions ISO RGD:1558558 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Rbm6 Rat formaldehyde decreases expression ISO RGD:1342651 6480464 Formaldehyde results in decreased expression of RBM6 mRNA CTD PMID:20655997 Rbm6 Rat FR900359 affects phosphorylation ISO RGD:1342651 6480464 FR900359 affects the phosphorylation of RBM6 protein CTD PMID:37730182 Rbm6 Rat indometacin multiple interactions ISO RGD:1342651 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Rbm6 Rat L-methionine multiple interactions ISO RGD:1558558 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Rbm6 Rat lead(0) affects splicing ISO RGD:1342651 6480464 Lead affects the splicing of RBM6 mRNA CTD PMID:28903495 Rbm6 Rat methylmercury chloride increases expression ISO RGD:1342651 6480464 methylmercuric chloride results in increased expression of RBM6 mRNA CTD PMID:28001369 Rbm6 Rat methylparaben increases expression ISO RGD:1342651 6480464 methylparaben results in increased expression of RBM6 mRNA CTD PMID:31745603 Rbm6 Rat mono(2-ethyl-5-oxohexyl) phthalate affects expression ISO RGD:1342651 6480464 mono(2-ethyl-5-oxohexyl)phthalate affects the expression of RBM6 mRNA CTD PMID:34478338 Rbm6 Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression ISO RGD:1342651 6480464 Methylnitronitrosoguanidine results in increased expression of RBM6 mRNA CTD PMID:12634122 Rbm6 Rat nickel atom decreases expression ISO RGD:1342651 6480464 Nickel results in decreased expression of RBM6 mRNA CTD PMID:23195993 Rbm6 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RBM6 mRNA CTD PMID:25729387 Rbm6 Rat ozone multiple interactions ISO RGD:1558558 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of RBM6 more ... CTD PMID:27106289 Rbm6 Rat paracetamol affects expression ISO RGD:1558558 6480464 Acetaminophen affects the expression of RBM6 mRNA CTD PMID:17562736 Rbm6 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of RBM6 mRNA CTD PMID:33387578 Rbm6 Rat paracetamol increases expression ISO RGD:1342651 6480464 Acetaminophen results in increased expression of RBM6 mRNA CTD PMID:29067470 Rbm6 Rat perfluorohexanesulfonic acid decreases expression ISO RGD:1558558 6480464 perfluorohexanesulfonic acid results in decreased expression of RBM6 mRNA CTD PMID:37995155 Rbm6 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1558558 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RBM6 mRNA CTD PMID:36331819 Rbm6 Rat sodium arsenite increases stability ISO RGD:1342651 6480464 sodium arsenite results in increased stability of RBM6 mRNA CTD PMID:25493608 Rbm6 Rat sunitinib increases expression ISO RGD:1342651 6480464 Sunitinib results in increased expression of RBM6 mRNA CTD PMID:31533062 Rbm6 Rat tebufenpyrad increases expression ISO RGD:1342651 6480464 4-chloro-N-((4-(1,1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of RBM6 mRNA CTD PMID:33512557 Rbm6 Rat thiram increases expression ISO RGD:1342651 6480464 Thiram results in increased expression of RBM6 mRNA CTD PMID:38568856 Rbm6 Rat titanium dioxide increases expression ISO RGD:1558558 6480464 titanium dioxide results in increased expression of RBM6 mRNA CTD PMID:29264374 Rbm6 Rat titanium dioxide increases methylation ISO RGD:1558558 6480464 titanium dioxide results in increased methylation of RBM6 gene CTD PMID:35295148 Rbm6 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RBM6 mRNA CTD PMID:25729387 Rbm6 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of RBM6 mRNA CTD PMID:25729387 Rbm6 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of RBM6 mRNA CTD PMID:33387578 Rbm6 Rat triphenyl phosphate affects expression ISO RGD:1342651 6480464 triphenyl phosphate affects the expression of RBM6 mRNA CTD PMID:37042841 Rbm6 Rat troglitazone decreases expression ISO RGD:1558558 6480464 troglitazone results in decreased expression of RBM6 mRNA CTD PMID:28973697 Rbm6 Rat tungsten decreases expression ISO RGD:1558558 6480464 Tungsten results in decreased expression of RBM6 mRNA CTD PMID:30912803 Rbm6 Rat valproic acid decreases expression ISO RGD:1342651 6480464 Valproic Acid results in decreased expression of RBM6 mRNA CTD PMID:23179753|PMID:29154799 Rbm6 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of RBM6 gene CTD PMID:31682807 Rbm6 Rat vincristine decreases expression ISO RGD:1342651 6480464 Vincristine results in decreased expression of RBM6 mRNA CTD PMID:23649840
Rbm6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 117,327,607 - 117,431,397 (-) NCBI GRCr8 mRatBN7.2 8 108,452,687 - 108,552,783 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 108,452,687 - 108,552,771 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 114,079,496 - 114,179,508 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 112,278,658 - 112,378,688 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 110,121,434 - 110,221,461 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 116,535,403 - 116,635,851 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 116,535,403 - 116,635,851 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 115,890,040 - 115,989,943 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 113,027,975 - 113,128,713 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 107,759,022 - 107,858,711 (-) NCBI Celera Cytogenetic Map 8 q32 NCBI
RBM6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 49,940,150 - 50,077,249 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 49,940,007 - 50,100,045 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 49,977,583 - 50,114,682 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 49,952,596 - 50,089,686 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 49,952,595 - 50,089,685 NCBI Celera 3 49,943,716 - 50,087,548 (+) NCBI Celera Cytogenetic Map 3 p21.31 NCBI HuRef 3 50,034,632 - 50,170,894 (+) NCBI HuRef CHM1_1 3 49,929,564 - 50,066,750 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 49,969,226 - 50,106,392 (+) NCBI T2T-CHM13v2.0
Rbm6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 107,650,758 - 107,751,028 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 107,650,758 - 107,750,436 (-) Ensembl GRCm39 Ensembl GRCm38 9 107,773,559 - 107,873,358 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 107,773,559 - 107,873,237 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 107,675,890 - 107,775,150 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 107,631,664 - 107,730,808 (-) NCBI MGSCv36 mm8 Celera 9 107,381,354 - 107,481,030 (-) NCBI Celera Cytogenetic Map 9 F1 NCBI
Rbm6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955532 1,811,794 - 1,916,328 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955532 1,811,794 - 1,914,551 (+) NCBI ChiLan1.0 ChiLan1.0
RBM6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 49,926,494 - 50,062,256 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 49,931,303 - 50,067,031 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 49,872,120 - 50,007,835 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 51,135,452 - 51,243,169 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 51,135,198 - 51,243,169 (+) Ensembl panpan1.1 panPan2
RBM6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 39,235,301 - 39,359,784 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 39,235,421 - 39,334,107 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 39,156,312 - 39,280,673 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 39,591,976 - 39,716,799 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 39,591,976 - 39,716,743 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 38,959,144 - 39,083,726 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 39,363,478 - 39,488,199 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 39,643,102 - 39,767,491 (-) NCBI UU_Cfam_GSD_1.0
Rbm6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 64,774,330 - 64,874,536 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936529 1,534,657 - 1,635,071 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936529 1,534,816 - 1,635,012 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RBM6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 32,444,963 - 32,569,815 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 32,444,944 - 32,569,818 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 35,625,690 - 35,749,685 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RBM6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 11,343,260 - 11,462,390 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 11,343,214 - 11,461,504 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 155,528,101 - 155,651,928 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rbm6
.
Predicted Target Of
Count of predictions: 147 Count of miRNA genes: 105 Interacting mature miRNAs: 108 Transcripts: ENSRNOT00000024939 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 724539 Cm19 Cardiac mass QTL 19 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 8 100149864 120994388 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 631217 Activ1 Activity QTL 1 15.9 voluntary movement trait (VT:0003491) number of photobeam interruptions in an experimental apparatus (CMO:0001517) 8 102370617 108923645 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
D8Got174
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 108,488,184 - 108,488,380 (+) MAPPER mRatBN7.2 Rnor_6.0 8 116,570,972 - 116,571,167 NCBI Rnor6.0 Rnor_5.0 8 115,925,561 - 115,925,756 UniSTS Rnor5.0 RGSC_v3.4 8 113,063,453 - 113,063,649 RGD RGSC3.4 RGSC_v3.4 8 113,063,454 - 113,063,649 UniSTS RGSC3.4 RGSC_v3.1 8 113,082,909 - 113,083,104 RGD Celera 8 107,794,310 - 107,794,505 UniSTS RH 3.4 Map 8 1119.2 UniSTS RH 3.4 Map 8 1119.2 RGD RH 2.0 Map 8 872.9 RGD Cytogenetic Map 8 q32 UniSTS
D8Got172
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 108,535,894 - 108,536,039 (+) MAPPER mRatBN7.2 Rnor_6.0 8 116,618,690 - 116,618,834 NCBI Rnor6.0 Rnor_5.0 8 115,972,795 - 115,972,939 UniSTS Rnor5.0 RGSC_v3.4 8 113,111,861 - 113,112,006 RGD RGSC3.4 RGSC_v3.4 8 113,111,862 - 113,112,006 UniSTS RGSC3.4 RGSC_v3.1 8 113,131,317 - 113,131,461 RGD Celera 8 107,841,918 - 107,842,062 UniSTS RH 3.4 Map 8 1118.2 UniSTS RH 3.4 Map 8 1118.2 RGD RH 2.0 Map 8 875.4 RGD Cytogenetic Map 8 q32 UniSTS
RH134297
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 108,504,383 - 108,504,563 (+) MAPPER mRatBN7.2 Rnor_6.0 8 116,587,183 - 116,587,362 NCBI Rnor6.0 Rnor_5.0 8 115,941,288 - 115,941,467 UniSTS Rnor5.0 RGSC_v3.4 8 113,080,356 - 113,080,535 UniSTS RGSC3.4 Celera 8 107,810,411 - 107,810,590 UniSTS RH 3.4 Map 8 1118.1 UniSTS Cytogenetic Map 8 q32 UniSTS
AU047598
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 108,516,269 - 108,516,535 (+) MAPPER mRatBN7.2 Rnor_6.0 8 116,599,066 - 116,599,331 NCBI Rnor6.0 Rnor_5.0 8 115,953,171 - 115,953,436 UniSTS Rnor5.0 RGSC_v3.4 8 113,092,239 - 113,092,504 UniSTS RGSC3.4 Celera 8 107,822,294 - 107,822,559 UniSTS Cytogenetic Map 8 q32 UniSTS
WI-18724
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 108,452,708 - 108,452,837 (+) MAPPER mRatBN7.2 Rnor_6.0 8 116,535,425 - 116,535,553 NCBI Rnor6.0 Rnor_5.0 8 115,890,062 - 115,890,190 UniSTS Rnor5.0 RGSC_v3.4 8 113,027,997 - 113,028,125 UniSTS RGSC3.4 Celera 8 107,759,044 - 107,759,172 UniSTS Cytogenetic Map 8 q32 UniSTS
Cfl1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 202,800,003 - 202,800,736 (+) MAPPER mRatBN7.2 mRatBN7.2 8 108,490,519 - 108,490,693 (+) MAPPER mRatBN7.2 Rnor_6.0 8 116,573,307 - 116,573,480 NCBI Rnor6.0 Rnor_6.0 1 220,872,010 - 220,872,742 NCBI Rnor6.0 Rnor_5.0 8 115,927,896 - 115,928,069 UniSTS Rnor5.0 Rnor_5.0 1 227,801,331 - 227,802,063 UniSTS Rnor5.0 RGSC_v3.4 8 113,065,789 - 113,065,962 UniSTS RGSC3.4 RGSC_v3.4 1 208,136,081 - 208,136,813 UniSTS RGSC3.4 Celera 8 107,796,645 - 107,796,818 UniSTS Celera 1 200,335,480 - 200,336,212 UniSTS Cytogenetic Map 1 q43 UniSTS Cytogenetic Map 8 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024939 ⟹ ENSRNOP00000024939
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 108,452,687 - 108,552,771 (-) Ensembl Rnor_6.0 Ensembl 8 116,535,403 - 116,635,851 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103192 ⟹ ENSRNOP00000086814
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 108,452,687 - 108,533,987 (-) Ensembl
RefSeq Acc Id:
NM_001108186 ⟹ NP_001101656
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,331,325 - 117,431,397 (-) NCBI mRatBN7.2 8 108,452,687 - 108,552,771 (-) NCBI Rnor_6.0 8 116,535,403 - 116,635,851 (-) NCBI Rnor_5.0 8 115,890,040 - 115,989,943 (-) NCBI RGSC_v3.4 8 113,027,975 - 113,128,713 (-) RGD Celera 8 107,759,022 - 107,858,711 (-) RGD
Sequence:
GCGGGATTTGCGCCCGTACTTCATCTCCCGGCGGGCCCAGCGCTGAAGGCGGTGGCGCGACGCCTTTGTGGAAGCCGGAGCCCACCGGGAGGAAGTTCCGGTCTCCGGGACGCTGGGTCCGTGGCGGC
hide sequence
RefSeq Acc Id:
XM_006243780 ⟹ XP_006243842
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,327,607 - 117,431,363 (-) NCBI mRatBN7.2 8 108,452,690 - 108,552,783 (-) NCBI Rnor_6.0 8 116,535,406 - 116,635,841 (-) NCBI Rnor_5.0 8 115,890,040 - 115,989,943 (-) NCBI
Sequence:
CGCCCGTACTTCATCTCCCGGCGGGCCCAGCGCTGAAGGCGGTGGCGCGACGCCTTTGTGGAAG
hide sequence
RefSeq Acc Id:
XM_006243781 ⟹ XP_006243843
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,327,607 - 117,431,071 (-) NCBI mRatBN7.2 8 108,452,690 - 108,552,583 (-) NCBI Rnor_6.0 8 116,535,406 - 116,635,672 (-) NCBI Rnor_5.0 8 115,890,040 - 115,989,943 (-) NCBI
Sequence:
GCCCAGGATACGAGAGAGGGCGTGCCCGAGCTGCTGGGATAGGGTCAGCGGTCCGGGCGGCTCT
hide sequence
RefSeq Acc Id:
XM_008766535 ⟹ XP_008764757
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,327,607 - 117,361,147 (-) NCBI mRatBN7.2 8 108,452,690 - 108,482,548 (-) NCBI Rnor_6.0 8 116,535,406 - 116,565,300 (-) NCBI
Sequence:
CAGAGCCCTGTCTGAGGAGACACAGAGGACCCTAGAGGGCGGAGAGTGAACACAGCGCAGGGGCTAGTTCCAGAGTCGCACCTTCGGGAACTCTAATGATCCATGACAAAGAAGTCACTCTTGAATAT
hide sequence
RefSeq Acc Id:
XM_039081594 ⟹ XP_038937522
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,327,607 - 117,431,363 (-) NCBI mRatBN7.2 8 108,452,690 - 108,552,780 (-) NCBI
RefSeq Acc Id:
XM_039081595 ⟹ XP_038937523
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,327,607 - 117,409,292 (-) NCBI mRatBN7.2 8 108,452,690 - 108,530,635 (-) NCBI
RefSeq Acc Id:
XM_063265628 ⟹ XP_063121698
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,327,607 - 117,431,363 (-) NCBI
RefSeq Acc Id:
XM_063265629 ⟹ XP_063121699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,327,607 - 117,431,363 (-) NCBI
RefSeq Acc Id:
NP_001101656 ⟸ NM_001108186
- UniProtKB:
D4ACW0 (UniProtKB/TrEMBL), A6I311 (UniProtKB/TrEMBL), A0A8I6A326 (UniProtKB/TrEMBL)
- Sequence:
MWGDSRSANRTGPFRGSQEERFAPGWNRDYPPPPLKSHAQERHPGNFPGRDSLPFDFQGHSGPPFANVEEHSFSYGARDGPHADYQGGEGPGHDFRGGDFSSSDFQSRDSAQLDFRNRDIHSGDFRDR
hide sequence
RefSeq Acc Id:
XP_006243842 ⟸ XM_006243780
- Peptide Label:
isoform X1
- UniProtKB:
D4ACW0 (UniProtKB/TrEMBL), A6I311 (UniProtKB/TrEMBL), A0A8I6A326 (UniProtKB/TrEMBL)
- Sequence:
MWGDSRSANRTGPFRGSQEERFAPGWNRDYPPPPLKSHAQERHPGNFPGRDSLPFDFQGHSGPPFANVEEHSFSYGARDGPHADYQGGEGPGHDFRGGDFSSSDFQSRDSAQLDFRNRDIHSGDFRDR
hide sequence
RefSeq Acc Id:
XP_006243843 ⟸ XM_006243781
- Peptide Label:
isoform X1
- UniProtKB:
D4ACW0 (UniProtKB/TrEMBL), A6I311 (UniProtKB/TrEMBL), A0A8I6A326 (UniProtKB/TrEMBL)
- Sequence:
MWGDSRSANRTGPFRGSQEERFAPGWNRDYPPPPLKSHAQERHPGNFPGRDSLPFDFQGHSGPPFANVEEHSFSYGARDGPHADYQGGEGPGHDFRGGDFSSSDFQSRDSAQLDFRNRDIHSGDFRDR
hide sequence
RefSeq Acc Id:
XP_008764757 ⟸ XM_008766535
- Peptide Label:
isoform X3
- Sequence:
MIHDKEVTLEYVPSPDFWYCKRCKASTGGHQSCCSYCKGPKEEVKQELVSYPQPQKTSIPVPSEKQPNQPRPVDKEHELRKREEGQESRLGHQKRETERYFPHSRREGLTFRRDREKESWSGETRQDG
hide sequence
Ensembl Acc Id:
ENSRNOP00000024939 ⟸ ENSRNOT00000024939
RefSeq Acc Id:
XP_038937522 ⟸ XM_039081594
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038937523 ⟸ XM_039081595
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSRNOP00000086814 ⟸ ENSRNOT00000103192
RefSeq Acc Id:
XP_063121699 ⟸ XM_063265629
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063121698 ⟸ XM_063265628
- Peptide Label:
isoform X2
RGD ID: 13696281 Promoter ID: EPDNEW_R6806 Type: multiple initiation site Name: Rbm6_1 Description: RNA binding motif protein 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 116,635,754 - 116,635,814 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-28
Rbm6
RNA binding motif protein 6
RGD1560367_predicted
similar to Rbm6 protein (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1560367_predicted
similar to Rbm6 protein (predicted)
LOC315997
similar to Rbm6 protein
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC315997
similar to Rbm6 protein
Symbol and Name status set to provisional
70820 PROVISIONAL
