Symbol:
Ciapin1
Name:
cytokine induced apoptosis inhibitor 1
RGD ID:
1549737
Description:
Predicted to enable 2 iron, 2 sulfur cluster binding activity and iron ion binding activity. Predicted to be involved in iron-sulfur cluster assembly. Predicted to act upstream of or within hemopoiesis and negative regulation of apoptotic process. Predicted to be located in mitochondrion; nucleolus; and nucleoplasm. Predicted to be active in cytoplasm. Orthologous to human CIAPIN1 (cytokine induced apoptosis inhibitor 1); PARTICIPATES IN cytosolic iron-sulfur cluster protein assembly pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1,3-dinitrobenzene; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
anamorsin; cytokine-induced apoptosis inhibitor 1; fe-S cluster assembly protein DRE2 homolog; MGC94686; similar to RIKEN cDNA 2810413N20
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CIAPIN1 (cytokine induced apoptosis inhibitor 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ciapin1 (cytokine induced apoptosis inhibitor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ciapin1 (cytokine induced apoptosis inhibitor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CIAPIN1 (cytokine induced apoptosis inhibitor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CIAPIN1 (cytokine induced apoptosis inhibitor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ciapin1 (cytokine induced apoptosis inhibitor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CIAPIN1 (cytokine induced apoptosis inhibitor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CIAPIN1 (cytokine induced apoptosis inhibitor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ciapin1 (cytokine induced apoptosis inhibitor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DAD1 (defender against cell death 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CIAPIN1 (cytokine induced apoptosis inhibitor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ciapin1 (cytokine induced apoptosis inhibitor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ciapin1 (cytokine induced apoptosis inhibitor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CIAPIN1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
DRE2
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T20B12.7
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ciapin1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 10,185,955 - 10,199,120 (+) NCBI GRCr8 mRatBN7.2 19 10,179,963 - 10,195,511 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 10,180,100 - 10,195,503 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 10,144,184 - 10,157,188 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 10,911,028 - 10,924,032 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 10,197,976 - 10,210,981 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 10,596,923 - 10,612,414 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 10,596,960 - 10,610,049 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 10,591,726 - 10,607,111 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 10,619,171 - 10,632,187 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 19 10,066,716 - 10,079,509 (+) NCBI Celera Cytogenetic Map 19 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ciapin1 Rat (1->4)-beta-D-glucan multiple interactions ISO Ciapin1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CIAPIN1 mRNA CTD PMID:36331819 Ciapin1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o and p'-DDT results in increased expression of CIAPIN1 mRNA CTD PMID:24096037 Ciapin1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Ciapin1 (Mus musculus) 6480464 o and p'-DDT results in increased expression of CIAPIN1 mRNA CTD PMID:24096037 Ciapin1 Rat 1,2-dimethylhydrazine multiple interactions ISO Ciapin1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of CIAPIN1 mRNA CTD PMID:22206623 Ciapin1 Rat 1,3-dinitrobenzene decreases expression EXP 6480464 3-dinitrobenzene results in decreased expression of CIAPIN1 mRNA CTD PMID:22841810 Ciapin1 Rat 17alpha-ethynylestradiol increases expression ISO Ciapin1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of CIAPIN1 mRNA CTD PMID:24096037 Ciapin1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of CIAPIN1 mRNA CTD PMID:24096037 Ciapin1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of CIAPIN1 mRNA CTD PMID:32145629 Ciapin1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ciapin1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CIAPIN1 mRNA CTD PMID:21570461 and PMID:24680724 Ciapin1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CIAPIN1 mRNA CTD PMID:33387578 Ciapin1 Rat 2,4-dinitrobenzenesulfonic acid increases expression ISO Ciapin1 (Mus musculus) 6480464 2 and 4-dinitrobenzenesulfonic acid results in increased expression of CIAPIN1 mRNA CTD PMID:30116771 Ciapin1 Rat 2-methylcholine affects expression ISO CIAPIN1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of CIAPIN1 mRNA CTD PMID:21179406 Ciapin1 Rat 4,4'-sulfonyldiphenol increases expression ISO Ciapin1 (Mus musculus) 6480464 bisphenol S results in increased expression of CIAPIN1 mRNA CTD PMID:39298647 Ciapin1 Rat aflatoxin B1 increases methylation ISO CIAPIN1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CIAPIN1 gene CTD PMID:27153756 Ciapin1 Rat all-trans-retinoic acid decreases expression ISO CIAPIN1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of CIAPIN1 mRNA CTD PMID:33167477 Ciapin1 Rat aristolochic acid A increases expression ISO CIAPIN1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CIAPIN1 mRNA CTD PMID:33212167 Ciapin1 Rat beauvericin decreases expression ISO CIAPIN1 (Homo sapiens) 6480464 beauvericin results in decreased expression of CIAPIN1 mRNA CTD PMID:29203277 Ciapin1 Rat benzo[a]pyrene multiple interactions ISO CIAPIN1 (Homo sapiens) 6480464 [Soot co-treated with Benzo(a)pyrene] results in increased expression of CIAPIN1 protein modified form CTD PMID:24464499 Ciapin1 Rat benzo[a]pyrene increases methylation ISO CIAPIN1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CIAPIN1 3' UTR CTD PMID:27901495 Ciapin1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CIAPIN1 mRNA CTD PMID:25181051 Ciapin1 Rat bisphenol A affects expression ISO CIAPIN1 (Homo sapiens) 6480464 bisphenol A affects the expression of CIAPIN1 protein CTD PMID:37567409 Ciapin1 Rat bisphenol A increases expression ISO CIAPIN1 (Homo sapiens) 6480464 bisphenol A results in increased expression of CIAPIN1 protein CTD PMID:34186270 Ciapin1 Rat bisphenol A multiple interactions ISO CIAPIN1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of CIAPIN1 gene CTD PMID:31601247 Ciapin1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CIAPIN1 mRNA CTD PMID:32145629 Ciapin1 Rat bisphenol AF increases expression ISO CIAPIN1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of CIAPIN1 protein CTD PMID:34186270 Ciapin1 Rat cadmium atom multiple interactions ISO CIAPIN1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CIAPIN1 mRNA CTD PMID:35301059 Ciapin1 Rat cadmium dichloride multiple interactions ISO CIAPIN1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CIAPIN1 mRNA CTD PMID:35301059 Ciapin1 Rat caffeine affects phosphorylation ISO CIAPIN1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of CIAPIN1 protein CTD PMID:35688186 Ciapin1 Rat carbon nanotube increases expression ISO Ciapin1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of CIAPIN1 mRNA CTD PMID:25620056 Ciapin1 Rat chlordecone increases expression ISO Ciapin1 (Mus musculus) 6480464 Chlordecone results in increased expression of CIAPIN1 mRNA CTD PMID:33711761 Ciapin1 Rat choline multiple interactions ISO Ciapin1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CIAPIN1 gene CTD PMID:20938992 Ciapin1 Rat clobetasol increases expression ISO Ciapin1 (Mus musculus) 6480464 Clobetasol results in increased expression of CIAPIN1 mRNA CTD PMID:27462272 Ciapin1 Rat Dibutyl phosphate affects expression ISO CIAPIN1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CIAPIN1 mRNA CTD PMID:37042841 Ciapin1 Rat doxorubicin decreases response to substance ISO CIAPIN1 (Homo sapiens) 6480464 CIAPIN1 protein results in decreased susceptibility to Doxorubicin CTD PMID:18389626 Ciapin1 Rat doxorubicin increases secretion ISO CIAPIN1 (Homo sapiens) 6480464 CIAPIN1 protein results in increased secretion of Doxorubicin CTD PMID:18389626 Ciapin1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of CIAPIN1 mRNA CTD PMID:29391264 Ciapin1 Rat etoposide decreases response to substance ISO CIAPIN1 (Homo sapiens) 6480464 CIAPIN1 protein results in decreased susceptibility to Etoposide CTD PMID:18389626 Ciapin1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CIAPIN1 mRNA CTD PMID:24136188 Ciapin1 Rat folic acid multiple interactions ISO Ciapin1 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Ciapin1 Rat FR900359 decreases phosphorylation ISO CIAPIN1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of CIAPIN1 protein CTD PMID:37730182 Ciapin1 Rat fulvestrant multiple interactions ISO CIAPIN1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of CIAPIN1 gene CTD PMID:31601247 Ciapin1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CIAPIN1 mRNA CTD PMID:33387578 Ciapin1 Rat inulin multiple interactions ISO Ciapin1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of CIAPIN1 mRNA CTD PMID:36331819 Ciapin1 Rat ivermectin decreases expression ISO CIAPIN1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CIAPIN1 protein CTD PMID:32959892 Ciapin1 Rat L-methionine multiple interactions ISO Ciapin1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CIAPIN1 gene CTD PMID:20938992 Ciapin1 Rat lead diacetate increases expression ISO Ciapin1 (Mus musculus) 6480464 lead acetate results in increased expression of CIAPIN1 mRNA CTD PMID:20542052 Ciapin1 Rat lead(0) affects expression ISO CIAPIN1 (Homo sapiens) 6480464 Lead affects the expression of CIAPIN1 mRNA CTD PMID:28903495 Ciapin1 Rat methamphetamine increases expression ISO Ciapin1 (Mus musculus) 6480464 Methamphetamine results in increased expression of CIAPIN1 mRNA CTD PMID:36914120 Ciapin1 Rat microcystin RR increases expression ISO CIAPIN1 (Homo sapiens) 6480464 microcystin RR results in increased expression of CIAPIN1 protein CTD PMID:19111056 Ciapin1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of CIAPIN1 mRNA CTD PMID:24136188 Ciapin1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of CIAPIN1 mRNA CTD PMID:24136188 Ciapin1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ciapin1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CIAPIN1 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of CIAPIN1 mRNA CTD PMID:36331819 Ciapin1 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of CIAPIN1 mRNA CTD PMID:28520973 Ciapin1 Rat phorone affects expression EXP 6480464 phorone affects the expression of CIAPIN1 mRNA CTD PMID:18198479 Ciapin1 Rat pirinixic acid increases expression ISO Ciapin1 (Mus musculus) 6480464 pirinixic acid results in increased expression of CIAPIN1 mRNA CTD PMID:23811191 Ciapin1 Rat quercetin decreases expression ISO CIAPIN1 (Homo sapiens) 6480464 Quercetin results in decreased expression of CIAPIN1 mRNA CTD PMID:23727915 Ciapin1 Rat sodium arsenite decreases expression ISO CIAPIN1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CIAPIN1 mRNA CTD PMID:38568856 Ciapin1 Rat sodium arsenite increases expression ISO CIAPIN1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CIAPIN1 mRNA CTD PMID:34032870 Ciapin1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of CIAPIN1 protein CTD PMID:35544339 Ciapin1 Rat thiram decreases expression ISO CIAPIN1 (Homo sapiens) 6480464 Thiram results in decreased expression of CIAPIN1 mRNA CTD PMID:38568856 Ciapin1 Rat titanium dioxide increases methylation ISO Ciapin1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of CIAPIN1 gene CTD PMID:35295148 Ciapin1 Rat triptonide increases expression ISO Ciapin1 (Mus musculus) 6480464 triptonide results in increased expression of CIAPIN1 mRNA CTD PMID:33045310 Ciapin1 Rat valproic acid decreases methylation ISO CIAPIN1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of CIAPIN1 gene CTD PMID:29154799 Ciapin1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of CIAPIN1 mRNA CTD PMID:22570695 Ciapin1 Rat vincristine decreases response to substance ISO CIAPIN1 (Homo sapiens) 6480464 CIAPIN1 protein results in decreased susceptibility to Vincristine CTD PMID:18389626
(1->4)-beta-D-glucan (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrobenzenesulfonic acid (ISO) 2-methylcholine (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) beauvericin (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) chlordecone (ISO) choline (ISO) clobetasol (ISO) Dibutyl phosphate (ISO) doxorubicin (ISO) endosulfan (EXP) etoposide (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gentamycin (EXP) inulin (ISO) ivermectin (ISO) L-methionine (ISO) lead diacetate (ISO) lead(0) (ISO) methamphetamine (ISO) microcystin RR (ISO) nefazodone (EXP) nimesulide (EXP) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (EXP) phorone (EXP) pirinixic acid (ISO) quercetin (ISO) sodium arsenite (ISO) thapsigargin (EXP) thiram (ISO) titanium dioxide (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO)
Ciapin1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 10,185,955 - 10,199,120 (+) NCBI GRCr8 mRatBN7.2 19 10,179,963 - 10,195,511 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 10,180,100 - 10,195,503 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 10,144,184 - 10,157,188 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 10,911,028 - 10,924,032 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 10,197,976 - 10,210,981 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 10,596,923 - 10,612,414 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 10,596,960 - 10,610,049 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 10,591,726 - 10,607,111 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 10,619,171 - 10,632,187 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 19 10,066,716 - 10,079,509 (+) NCBI Celera Cytogenetic Map 19 p13 NCBI
CIAPIN1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 57,428,187 - 57,447,385 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 57,428,187 - 57,447,420 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 57,462,099 - 57,481,297 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 56,019,587 - 56,038,870 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 56,019,581 - 56,032,341 NCBI Celera 16 41,962,936 - 41,982,221 (-) NCBI Celera Cytogenetic Map 16 q21 NCBI HuRef 16 43,329,733 - 43,349,016 (-) NCBI HuRef CHM1_1 16 58,870,146 - 58,889,429 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 63,223,362 - 63,242,561 (-) NCBI T2T-CHM13v2.0
Ciapin1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 95,546,446 - 95,565,454 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 95,546,432 - 95,564,986 (-) Ensembl GRCm39 Ensembl GRCm38 8 94,819,818 - 94,838,830 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 94,819,804 - 94,838,358 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 97,343,718 - 97,362,240 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 97,708,947 - 97,727,469 (-) NCBI MGSCv36 mm8 Celera 8 99,144,006 - 99,162,184 (-) NCBI Celera Cytogenetic Map 8 C5 NCBI cM Map 8 46.86 NCBI
Ciapin1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 15,065,031 - 15,081,293 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 15,065,031 - 15,081,392 (-) NCBI ChiLan1.0 ChiLan1.0
CIAPIN1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 66,896,003 - 66,917,703 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 72,816,823 - 72,838,576 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 37,701,773 - 37,723,556 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 56,835,024 - 56,856,502 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 56,835,024 - 56,856,502 (-) Ensembl panpan1.1 panPan2
CIAPIN1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 58,977,592 - 58,992,785 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 58,977,676 - 58,992,581 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 55,607,027 - 55,622,240 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 59,516,013 - 59,531,188 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 59,516,048 - 59,531,834 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 56,347,304 - 56,362,485 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 57,355,010 - 57,370,223 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 58,248,470 - 58,263,682 (+) NCBI UU_Cfam_GSD_1.0
Ciapin1
CIAPIN1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 19,356,069 - 19,373,060 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 19,356,065 - 19,373,085 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 17,323,846 - 17,335,336 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CIAPIN1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 43,360,465 - 43,378,561 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 43,359,399 - 43,378,686 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 32,840,525 - 32,858,606 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ciapin1
.
Predicted Target Of
Count of predictions: 989 Count of miRNA genes: 328 Interacting mature miRNAs: 459 Transcripts: ENSRNOT00000021769 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat
BE102514
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 10,194,005 - 10,194,199 (+) MAPPER mRatBN7.2 Rnor_6.0 19 10,610,909 - 10,611,102 NCBI Rnor6.0 Rnor_5.0 19 10,605,606 - 10,605,799 UniSTS Rnor5.0 RGSC_v3.4 19 10,633,065 - 10,633,258 UniSTS RGSC3.4 Celera 19 10,080,387 - 10,080,580 UniSTS RH 3.4 Map 19 100.3 UniSTS Cytogenetic Map 19 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021769 ⟹ ENSRNOP00000021769
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 10,180,100 - 10,195,503 (+) Ensembl Rnor_6.0 Ensembl 19 10,596,960 - 10,610,049 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116645 ⟹ ENSRNOP00000096214
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 10,180,508 - 10,195,503 (+) Ensembl
RefSeq Acc Id:
NM_001007689 ⟹ NP_001007690
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 10,186,102 - 10,199,120 (+) NCBI mRatBN7.2 19 10,180,109 - 10,193,128 (+) NCBI Rnor_6.0 19 10,597,014 - 10,610,031 (+) NCBI Rnor_5.0 19 10,591,726 - 10,607,111 (+) NCBI RGSC_v3.4 19 10,619,171 - 10,632,187 (+) RGD Celera 19 10,066,716 - 10,079,509 (+) RGD
Sequence:
CGCTCGGGGTGTCTCGAGCACCTGACCGGGCTTAACGGCCCTCTTTGAAGCCTTCTCGTCTTCCGTCCTCTCGCTCCGGTCCCGGCGCCGTCCTTGGTACGCCTGGGAAAGTCAGTGTGAGGGGCCGC
hide sequence
RefSeq Acc Id:
XM_006255106 ⟹ XP_006255168
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 10,186,247 - 10,199,120 (+) NCBI mRatBN7.2 19 10,180,050 - 10,195,511 (+) NCBI Rnor_6.0 19 10,596,966 - 10,612,414 (+) NCBI Rnor_5.0 19 10,591,726 - 10,607,111 (+) NCBI
Sequence:
AAGCCGGTGTCTACCGAGCGTGTTTTCAGGCTCTGAGGAAGGTGAGGACGCTCGGGGTGTCTCG
hide sequence
RefSeq Acc Id:
XM_006255107 ⟹ XP_006255169
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 10,185,955 - 10,199,120 (+) NCBI mRatBN7.2 19 10,179,963 - 10,195,511 (+) NCBI Rnor_6.0 19 10,596,923 - 10,610,040 (+) NCBI Rnor_5.0 19 10,591,726 - 10,607,111 (+) NCBI
Sequence:
CTCAGACGCTGTGCGGCATCTTCTCGCGAGAGATTGGAACGAGAAGCCGGTGTCTACCGAGCGT
hide sequence
RefSeq Acc Id:
XM_006255108 ⟹ XP_006255170
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 10,185,963 - 10,199,120 (+) NCBI mRatBN7.2 19 10,179,999 - 10,195,511 (+) NCBI Rnor_6.0 19 10,596,929 - 10,612,414 (+) NCBI Rnor_5.0 19 10,591,726 - 10,607,111 (+) NCBI
Sequence:
CGCTGTGCGGCATCTTCTCGCGAGAGATTGGAACGAGAAGCCGGTGTCTACCGAGCGTGTTTTCAGGCTCTGAGGAAGTAGCATTTAGGTCCAGCAGCTCTGCAGGAATGGCCGAGTTTGGGATCTCC
hide sequence
RefSeq Acc Id:
XM_039097710 ⟹ XP_038953638
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 10,186,387 - 10,199,120 (+) NCBI mRatBN7.2 19 10,180,052 - 10,195,511 (+) NCBI
RefSeq Acc Id:
XM_063277990 ⟹ XP_063134060
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 10,186,387 - 10,199,120 (+) NCBI
RefSeq Acc Id:
NP_001007690 ⟸ NM_001007689
- UniProtKB:
Q5XID1 (UniProtKB/Swiss-Prot), A6JY45 (UniProtKB/TrEMBL), A0A8I6ASY3 (UniProtKB/TrEMBL)
- Sequence:
MAEFGISPGQLVAVFCDKSSSEEALKKLVGRVQGLTGSEGQVFVENITQLLQSAHKESSFDVILSGIVPGSTSLHSPEALADMARILRPGGCLFLKEPVETTGVNNDKIKTASKLCSALTLSGLVEIK
hide sequence
RefSeq Acc Id:
XP_006255169 ⟸ XM_006255107
- Peptide Label:
isoform X1
- UniProtKB:
Q5XID1 (UniProtKB/Swiss-Prot), A6JY45 (UniProtKB/TrEMBL), A0A8I6ASY3 (UniProtKB/TrEMBL)
- Sequence:
MAEFGISPGQLVAVFCDKSSSEEALKKLVGRVQGLTGSEGQVFVENITQLLQSAHKESSFDVIL
hide sequence
RefSeq Acc Id:
XP_006255170 ⟸ XM_006255108
- Peptide Label:
isoform X1
- UniProtKB:
Q5XID1 (UniProtKB/Swiss-Prot), A6JY45 (UniProtKB/TrEMBL), A0A8I6ASY3 (UniProtKB/TrEMBL)
- Sequence:
MAEFGISPGQLVAVFCDKSSSEEALKKLVGRVQGLTGSEGQVFVENITQLLQSAHKESSFDVILSGIVPGSTSLHSPEALADMARILRPGGCLFLKEPVETTGVNNDKIKTASKLCSALTLSGLVEIK
hide sequence
RefSeq Acc Id:
XP_006255168 ⟸ XM_006255106
- Peptide Label:
isoform X1
- UniProtKB:
Q5XID1 (UniProtKB/Swiss-Prot), A6JY45 (UniProtKB/TrEMBL), A0A8I6ASY3 (UniProtKB/TrEMBL)
- Sequence:
MAEFGISPGQLVAVFCDKSSSEEALKKLVGRVQGLTGSEGQVFVENITQLLQSAHKESSFDVIL
hide sequence
Ensembl Acc Id:
ENSRNOP00000021769 ⟸ ENSRNOT00000021769
RefSeq Acc Id:
XP_038953638 ⟸ XM_039097710
- Peptide Label:
isoform X1
- UniProtKB:
Q5XID1 (UniProtKB/Swiss-Prot), A6JY45 (UniProtKB/TrEMBL), A0A8I6ASY3 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000096214 ⟸ ENSRNOT00000116645
RefSeq Acc Id:
XP_063134060 ⟸ XM_063277990
- Peptide Label:
isoform X1
- UniProtKB:
Q5XID1 (UniProtKB/Swiss-Prot), A6JY45 (UniProtKB/TrEMBL), A0A8I6ASY3 (UniProtKB/TrEMBL)
RGD ID: 13700940 Promoter ID: EPDNEW_R11464 Type: initiation region Name: Ciapin1_1 Description: cytokine induced apoptosis inhibitor 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 10,596,993 - 10,597,053 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Ciapin1
cytokine induced apoptosis inhibitor 1
MGC94686
similar to RIKEN cDNA 2810413N20
Symbol and Name updated
1299863 APPROVED
2005-09-15
MGC94686
similar to RIKEN cDNA 2810413N20
Symbol and Name status set to provisional
70820 PROVISIONAL
