Advanced Search (OLGA)

Gene: Or12d13 (olfactory receptor family 12 subfamily D member 13) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Or12d13

Name:

olfactory receptor family 12 subfamily D member 13

RGD ID:

1334232

Description:

Predicted to enable G protein-coupled receptor activity and olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in plasma membrane. Orthologous to human OR12D1 (olfactory receptor family 12 subfamily D member 1 (gene/pseudogene)).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 1734; olfactory receptor gene Olr1734; olfactory receptor Olr1734; Olr1734

RGD Orthologs

Human

Bonobo

Pig

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	1,250,936 - 1,251,877 (+)	NCBI		GRCr8
mRatBN7.2	20	1,245,689 - 1,246,630 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	1,243,080 - 1,248,655 (+)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	20	1,172,896 - 1,176,363 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	1,295,861 - 1,296,802 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	1,299,347 - 1,300,288 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	1,243,966 - 1,244,907 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	1,736,391 - 1,737,332 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	1,736,377 - 1,737,362 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	3,780,134 - 3,781,075 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	1,336,577 - 1,337,518 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	1,336,576 - 1,337,518 (+)	NCBI
Celera	20	1,959,220 - 1,960,161 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or12d13	Rat	detection of chemical stimulus involved in sensory perception of smell	involved_in	IEA	GO:0004984	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Or12d13	Rat	detection of chemical stimulus involved in sensory perception of smell		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or12d13	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or12d13	Rat	G protein-coupled receptor signaling pathway		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or12d13	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 and InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or12d13	Rat	sensory perception of smell	involved_in	IEA	UniProtKB-KW:KW-0552	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or12d13	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or12d13	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or12d13	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or12d13	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or12d13	Rat	plasma membrane	located_in	IEA	ARBA:ARBA00027801	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Or12d13	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or12d13	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or12d13	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or12d13	Rat	odorant binding	enables	IBA	MGI:3030853 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or12d13	Rat	olfactory receptor activity	enables	IBA	MGI:3030069 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or12d13	Rat	olfactory receptor activity		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or12d13	Rat	olfactory receptor activity	enables	IEA	InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or12d13	Rat	taste/olfaction phenotype		IEA		1303377		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Or12d13
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	1,250,936 - 1,251,877 (+)	NCBI		GRCr8
mRatBN7.2	20	1,245,689 - 1,246,630 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	1,243,080 - 1,248,655 (+)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	20	1,172,896 - 1,176,363 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	1,295,861 - 1,296,802 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	1,299,347 - 1,300,288 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	1,243,966 - 1,244,907 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	1,736,391 - 1,737,332 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	1,736,377 - 1,737,362 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	3,780,134 - 3,781,075 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	1,336,577 - 1,337,518 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	1,336,576 - 1,337,518 (+)	NCBI
Celera	20	1,959,220 - 1,960,161 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

OR12D1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	29,417,065 - 29,418,396 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	29,414,928 - 29,418,905 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	29,384,842 - 29,386,173 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	29,492,921 - 29,494,052 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	6	30,990,987 - 30,992,118 (+)	NCBI		Celera
Cytogenetic Map	6	p22.1	NCBI
HuRef	6	29,192,098 - 29,193,229 (+)	NCBI		HuRef
CHM1_1	6	29,387,035 - 29,388,166 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	29,291,723 - 29,293,054 (+)	NCBI		T2T-CHM13v2.0

LOC100991359
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	44,047,517 - 44,052,134 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	40,010,832 - 40,015,450 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	29,234,746 - 29,236,387 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	29,894,107 - 29,895,451 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

LOC100155349
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa10.2	7	25,740,114 - 25,741,040 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants in Or12d13
3 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	85
Count of miRNA genes:	68
Interacting mature miRNAs:	72
Transcripts:	ENSRNOT00000047035
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
724519	Bp144	Blood pressure QTL 144		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	20	1	3624629	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	hemolymphoid system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
5	2	2	35	30	22	18	3	45	38	18	1	12	22


RefSeq Transcripts	NM_001001119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC112568	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000047035 ⟹ ENSRNOP00000045233

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	1,172,896 - 1,176,363 (-)	Ensembl
Rnor_6.0 Ensembl	20	1,736,377 - 1,737,362 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095997 ⟹ ENSRNOP00000089268

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	1,243,080 - 1,248,655 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097118 ⟹ ENSRNOP00000090185

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	1,244,543 - 1,248,655 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111148 ⟹ ENSRNOP00000080774

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	1,243,585 - 1,248,655 (+)	Ensembl

RefSeq Acc Id:

NM_001001119 ⟹ NP_001001119

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	1,250,936 - 1,251,877 (+)	NCBI
mRatBN7.2	20	1,245,689 - 1,246,630 (+)	NCBI
Rnor_6.0	20	1,736,391 - 1,737,332 (+)	NCBI
Rnor_5.0	20	3,780,134 - 3,781,075 (+)	NCBI
RGSC_v3.4	20	1,336,577 - 1,337,518 (+)	RGD
Celera	20	1,959,220 - 1,960,161 (+)	RGD

Sequence:

show sequence

ATGTTGAATCAAACCTCTGTCAAAGAGTTTGTCCTGTTGGGAGTGACAGACTTACAAGAACCACAGCCTTTTCTCTTTGCTATTTTCCTCATCATCTACTTTGTCAATATAACTGGGAATGGAGCCAT
CCTGATGATCGTCATCTTGGACCAAAAACTCCACTCACCTATGTACTTCTTCCTGGGAAACCTAGCATGTCTAGATATCTGCTACTCCACTGTGACAGTGCCAAAGATGCTAAAGAACCTCCTCTCCA
CAAGCAAAGCAATTTCCTTCTTGGGATGCATAACTCAGCTTCATTTCTTCCACTTCCTGGGTACCACAGAATCACTGCTGCTCGCAGTGATGGCATTTGACCGTTTTGTGGCAATCTGCAAACCACTC
CACTATCCCATCATCATGAATTGGCAGATTTGTATCCTTATGGCTGTGACCATCTGGACCATTGCTTTTCTCCATGCCTTGCTTCACTCTGTAATGACATCTCGTTTGAGCTTCTGTGGTCCCAATCA
TGTCCATCATTTCTTCTGTGATGTTAAGCCATTGCTGGAGCTGGCCTGTGGAAACACTGAGCTCAACCTTTGGCTGCTCAATACAGTTACAGGTACTGTTGCCTCAGTTCCCTTTTTTCTGACATTTC
TCTCCTATTTCTACATCATCACTTATCTTTTCCTCAAGACCCGTTCTTGTAGCATGCTCCACAAAGCACTATCCACTTGTGCCTCTCACTTCATGGTTGTTATTCTGTTCTATGCTCCTGTTCTCTTC
ACCTACATCCGTCCCGCCTCAGGCAACTCTCTGGATCAGGACAGAATCATTGCCATCATGTACAGTGTGGTCACTCCTGCTCTCAACCCACTCATCTACACCTTGAGAAACAAAGAAGTGAGGAATGC
ATTGAATAGGAAGGTGAGGAGATGTCTCTTTCTTGAAGAAATCTAA

hide sequence


Protein RefSeqs	NP_001001119	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000045233.2
	ENSRNOP00000080774.1
	ENSRNOP00000089268.1
	ENSRNOP00000090185.1

RefSeq Acc Id:

NP_001001119 ⟸ NM_001001119

- UniProtKB:

A0A8I6ABK6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLNQTSVKEFVLLGVTDLQEPQPFLFAIFLIIYFVNITGNGAILMIVILDQKLHSPMYFFLGNLACLDICYSTVTVPKMLKNLLSTSKAISFLGCITQLHFFHFLGTTESLLLAVMAFDRFVAICKPL
HYPIIMNWQICILMAVTIWTIAFLHALLHSVMTSRLSFCGPNHVHHFFCDVKPLLELACGNTELNLWLLNTVTGTVASVPFFLTFLSYFYIITYLFLKTRSCSMLHKALSTCASHFMVVILFYAPVLF
TYIRPASGNSLDQDRIIAIMYSVVTPALNPLIYTLRNKEVRNALNRKVRRCLFLEEI

hide sequence

Ensembl Acc Id:

ENSRNOP00000045233 ⟸ ENSRNOT00000047035

Ensembl Acc Id:

ENSRNOP00000090185 ⟸ ENSRNOT00000097118

Ensembl Acc Id:

ENSRNOP00000089268 ⟸ ENSRNOT00000095997

Ensembl Acc Id:

ENSRNOP00000080774 ⟸ ENSRNOT00000111148

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ACU7-F1-model_v2	AlphaFold	D4ACU7	1-313	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-5011	BioCyc
Ensembl Genes	ENSRNOG00000058776	Ensembl
	ENSRNOG00000067841	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000070408	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000047035.3	UniProtKB/TrEMBL
	ENSRNOT00000095997.1	UniProtKB/TrEMBL
	ENSRNOT00000097118.1	UniProtKB/TrEMBL
	ENSRNOT00000111148.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
	Olfactory_GPCR	UniProtKB/TrEMBL
KEGG Report	rno:406018	UniProtKB/TrEMBL
NCBI Gene	406018	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or12d13	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000058776	RatGTEx
	ENSRNOG00000067841	RatGTEx
	ENSRNOG00000070408	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A8I6ABK6	ENTREZGENE, UniProtKB/TrEMBL
	D4ACU7_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or12d13	olfactory receptor family 12 subfamily D member 13	Olr1734	olfactory receptor 1734	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1734	olfactory receptor 1734	Olr1734_predicted	olfactory receptor 1734 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr1734_predicted	olfactory receptor 1734 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Mammalian Phenotype