Advanced Search (OLGA)

Gene: Olr765 (olfactory receptor 765) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Olr765 (Ensembl: Or4f4a)

Name:

olfactory receptor 765 (Ensembl:olfactory receptor family 4 subfamily F member 4A)

RGD ID:

1334032

Description:

Predicted to enable G protein-coupled receptor activity and olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in plasma membrane. Orthologous to human OR4F17 (olfactory receptor family 4 subfamily F member 17); INTERACTS WITH bisphenol A; 2-palmitoylglycerol (ortholog); aflatoxin B1 (ortholog).

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

olfactory receptor 4F4; olfactory receptor 765 (predicted); olfactory receptor gene Olr765; olfactory receptor Olr765; Olr765_predicted

RGD Orthologs

Human

Mouse

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	118,573,260 - 118,575,527 (+)	NCBI		GRCr8
mRatBN7.2	3	98,118,744 - 98,121,011 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	98,097,957 - 98,101,421 (+)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	3	98,117,901 - 98,121,398 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	3	102,722,070 - 102,724,337 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	102,723,402 - 102,724,337 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	109,318,406 - 109,320,673 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	97,102,313 - 97,104,580 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	97,122,095 - 97,124,362 (+)	NCBI		Celera
Cytogenetic Map	3	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Olr765	Rat	2-palmitoylglycerol	increases expression	ISO	OR4F17 (Homo sapiens)	6480464	2-palmitoylglycerol results in increased expression of OR4F17 mRNA	CTD	PMID:37199045
Olr765	Rat	aflatoxin B1	decreases methylation	ISO	OR4F17 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of OR4F17 gene	CTD	PMID:27153756
Olr765	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OR4F17 mRNA	CTD	PMID:25181051
Olr765	Rat	niclosamide	decreases expression	ISO	OR4F17 (Homo sapiens)	6480464	Niclosamide results in decreased expression of OR4F17 mRNA	CTD	PMID:36318118

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Olr765	Rat	detection of chemical stimulus involved in sensory perception of smell	involved_in	IEA	GO:0004984	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Olr765	Rat	detection of chemical stimulus involved in sensory perception of smell		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Olr765	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Olr765	Rat	G protein-coupled receptor signaling pathway		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Olr765	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 and InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Olr765	Rat	sensory perception of smell	involved_in	IEA	UniProtKB-KW:KW-0552	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Olr765	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Olr765	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Olr765	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Olr765	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Olr765	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Olr765	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Olr765	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Olr765	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Olr765	Rat	olfactory receptor activity	enables	IEA	InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Olr765	Rat	olfactory receptor activity		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Olr765	Rat	taste/olfaction phenotype		IEA		1303377		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Olr765
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	118,573,260 - 118,575,527 (+)	NCBI		GRCr8
mRatBN7.2	3	98,118,744 - 98,121,011 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	98,097,957 - 98,101,421 (+)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	3	98,117,901 - 98,121,398 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	3	102,722,070 - 102,724,337 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	102,723,402 - 102,724,337 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	109,318,406 - 109,320,673 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	97,102,313 - 97,104,580 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	97,122,095 - 97,124,362 (+)	NCBI		Celera
Cytogenetic Map	3	q34	NCBI

OR4F17
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	107,104 - 113,156 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	107,104 - 117,102 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	107,104 - 113,156 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	61,679 - 62,596 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	61,678 - 62,596	NCBI
Cytogenetic Map	19	p13.3	NCBI
CHM1_1	19	110,433 - 111,350 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	58,109 - 64,470 (+)	NCBI		T2T-CHM13v2.0

Or4f17
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	111,357,649 - 111,358,587 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	111,355,548 - 111,363,624 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	111,527,304 - 111,528,242 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	111,525,203 - 111,533,279 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	111,357,822 - 111,368,399 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	111,318,504 - 111,337,309 (+)	NCBI		MGSCv36	mm8
Celera	2	112,673,875 - 112,684,451 (+)	NCBI		Celera
Cytogenetic Map	2	E3	NCBI
cM Map	2	56.75	NCBI

Variants in Olr765
2 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	19
Count of miRNA genes:	19
Interacting mature miRNAs:	19
Transcripts:	ENSRNOT00000040298
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	84091273	129091273	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1582252	Sual1	Serum uric acid level QTL 1	3.4	0.0123	blood uric acid amount (VT:0010302)	blood uric acid level (CMO:0000501)	3	96127817	102200699	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_006224642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000040298 ⟹ ENSRNOP00000050284

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	98,097,957 - 98,101,421 (+)	Ensembl
Rnor_6.0 Ensembl	3	102,723,402 - 102,724,337 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089603 ⟹ ENSRNOP00000075150

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	98,117,901 - 98,121,398 (+)	Ensembl

RefSeq Acc Id:

XM_006234700 ⟹ XP_006234762

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	118,573,260 - 118,575,527 (+)	NCBI
mRatBN7.2	3	98,118,744 - 98,121,011 (+)	NCBI
Rnor_6.0	3	102,722,070 - 102,724,337 (+)	NCBI
Rnor_5.0	3	109,318,406 - 109,320,673 (+)	NCBI

Sequence:

show sequence

ATGCTCGGCTGTAAGTATCATATACGCAGTGCAAGTTCAGAGACTGTCTTCTGGAATGAATCAACAACAGAAGCAAATCGCTCTGCAGTGAAAGAATTTATTTTTATTGGACTCTCTGATTCTCAGGA
ACTTCAGATTTTTCTGTTTGTATTCTTTTTGGTTTTCTATGTAGGAATTGTATTTGGAAACCTTCTTATTGTCATGACTGTGAGCTATGATTCCCATCTCCACTCTCCTATGTACTTCCTATTGGCCA
ACCTCTCATTCGTTGATCTGTGTCTGTCCTCTGTCACAGCGCCGAAGATGATTGCTGATTTTTTCAGCAAACGCAAAGTCATCTCTGTTCATGGCTGTTTTGCACAGATTTTTCTCCTTCACTTCTTT
GGAGGGTGTGAGCTAGTGACCCTCATAGCCATGGCCTTTGATAGATATGTAGCAATTTGTAAGCCTCTGAGCTATACTACAATTATGTGTGGAAATGTGTGTGTGGGCATTGTGGTTACTGCATGGGG
AATTGGCTTCCTACATTCAGTGAGCCAATTGGCCTTTGCAGTGAACTTACCCTTTTGTGGTCCCAATAAGGTCGATAGTTTTTATTGTGACCTGCCTAGGGTACTCAAACTTGCCTGTGCAGACACAT
ATAGGTTAGACATCATGGTTATTGCCAACAGTGGTGTACTTACTGTGTGTTCCTTTGTTCTGCTAATCATCTCCTATGGTATCATTTTATTGACCATCCAGCGCCGCCCTTCTGATAGGTCATCTAAG
GCTCTGTCTACACTGACTGCTCATATCACAGTAGTTCTTCTGTTCTTTGGACCTTGCATCTTTATTTATGCCTGGCCCTTTCCCATCAAATCATTAGATAAATTCCTTGCTGTGTTTTATTCTGTGGT
CACCCCTCTCTTGAACCCTATTATATACACACTGAGGAACACAGAGATGAAAACTGCCATGAAACGCCTAAGACAATGGAATTTAAATTTTTGGGTGAAGTCTTAG

hide sequence


Protein RefSeqs	XP_006234762	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000075150.2

RefSeq Acc Id:

XP_006234762 ⟸ XM_006234700

- UniProtKB:

A0A0G2K9V9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLGCKYHIRSASSETVFWNESTTEANRSAVKEFIFIGLSDSQELQIFLFVFFLVFYVGIVFGNLLIVMTVSYDSHLHSPMYFLLANLSFVDLCLSSVTAPKMIADFFSKRKVISVHGCFAQIFLLHFF
GGCELVTLIAMAFDRYVAICKPLSYTTIMCGNVCVGIVVTAWGIGFLHSVSQLAFAVNLPFCGPNKVDSFYCDLPRVLKLACADTYRLDIMVIANSGVLTVCSFVLLIISYGIILLTIQRRPSDRSSK
ALSTLTAHITVVLLFFGPCIFIYAWPFPIKSLDKFLAVFYSVVTPLLNPIIYTLRNTEMKTAMKRLRQWNLNFWVKS

hide sequence

Ensembl Acc Id:

ENSRNOP00000050284 ⟸ ENSRNOT00000040298

Ensembl Acc Id:

ENSRNOP00000075150 ⟸ ENSRNOT00000089603

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LT92-F1-model_v2	AlphaFold	F1LT92	1-311	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-48438	BioCyc
Ensembl Genes	ENSRNOG00000046942	Ensembl
	ENSRNOG00000055449	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000089603.2	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
	Olfactory_Receptors	UniProtKB/TrEMBL
NCBI Gene	Olr765	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Olr765	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000046942	RatGTEx
	ENSRNOG00000055449	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A0G2K9V9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Olr765	olfactory receptor 765	Olr765_predicted	olfactory receptor 765 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr765_predicted	olfactory receptor 765 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Mammalian Phenotype