Symbol:
Cgn
Name:
cingulin
RGD ID:
1311992
Description:
Predicted to enable microtubule binding activity. Predicted to be involved in microtubule cytoskeleton organization. Predicted to act upstream of or within bicellular tight junction assembly and epithelial cell morphogenesis. Predicted to be located in apical junction complex; brush border; and plasma membrane. Predicted to be part of myosin complex. Predicted to be active in bicellular tight junction. Orthologous to human CGN (cingulin); INTERACTS WITH (+)-schisandrin B; 1,3-dinitrobenzene; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC310655
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CGN (cingulin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Cgn (cingulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cgn (cingulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CGN (cingulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CGN (cingulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cgn (cingulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CGN (cingulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CGN (cingulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cgn (cingulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CGN (cingulin)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cgn (cingulin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cgnb (cingulin b)
Alliance
DIOPT (Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cgn
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 184,997,425 - 185,024,785 (-) NCBI GRCr8 mRatBN7.2 2 182,308,389 - 182,335,747 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 182,308,714 - 182,334,645 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 2 195,909,691 - 195,937,130 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 195,909,626 - 195,935,878 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 215,388,309 - 215,415,608 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 189,645,082 - 189,670,491 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 189,598,427 - 189,623,829 (-) NCBI Celera 2 174,853,719 - 174,881,121 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cgn Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CGN mRNA] CTD PMID:31150632 Cgn Rat (1->4)-beta-D-glucan multiple interactions ISO Cgn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CGN mRNA CTD PMID:36331819 Cgn Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of CGN mRNA CTD PMID:24140754 Cgn Rat 17beta-estradiol decreases expression ISO CGN (Homo sapiens) 6480464 Estradiol results in decreased expression of CGN mRNA CTD PMID:20106945 and PMID:24758408 Cgn Rat 17beta-estradiol increases expression ISO Cgn (Mus musculus) 6480464 Estradiol results in increased expression of CGN mRNA CTD PMID:39298647 Cgn Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of CGN mRNA CTD PMID:32145629 Cgn Rat 17beta-estradiol multiple interactions ISO CGN (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of CGN mRNA more ... CTD PMID:20404318 more ... Cgn Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cgn (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CGN mRNA CTD PMID:19933214 Cgn Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CGN mRNA CTD PMID:21215274 and PMID:33387578 Cgn Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of CGN mRNA] CTD PMID:21215274 Cgn Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO CGN (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of CGN mRNA CTD PMID:22298810 Cgn Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Cgn (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Cgn Rat 2-hydroxypropanoic acid decreases expression ISO CGN (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CGN mRNA CTD PMID:30851411 Cgn Rat 4,4'-sulfonyldiphenol increases expression ISO Cgn (Mus musculus) 6480464 bisphenol S results in increased expression of CGN mRNA CTD PMID:30951980 Cgn Rat 4,4'-sulfonyldiphenol decreases methylation ISO CGN (Homo sapiens) 6480464 bisphenol S results in decreased methylation of CGN gene CTD PMID:31601247 Cgn Rat 4,4'-sulfonyldiphenol affects expression ISO Cgn (Mus musculus) 6480464 bisphenol S affects the expression of CGN mRNA CTD PMID:39298647 Cgn Rat 4-hydroxyphenyl retinamide increases expression ISO Cgn (Mus musculus) 6480464 Fenretinide results in increased expression of CGN mRNA CTD PMID:28973697 Cgn Rat 8-Br-cAMP increases expression ISO CGN (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of CGN mRNA CTD PMID:22079614 Cgn Rat aconitine increases expression EXP 6480464 Aconitine results in increased expression of CGN protein CTD PMID:33236894 Cgn Rat afimoxifene multiple interactions ISO CGN (Homo sapiens) 6480464 afimoxifene inhibits the reaction [Estrogens results in decreased expression of CGN mRNA] CTD PMID:21233418 Cgn Rat aflatoxin B1 affects expression ISO CGN (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of CGN protein CTD PMID:20106945 Cgn Rat aflatoxin B1 increases methylation ISO CGN (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CGN gene CTD PMID:27153756 Cgn Rat aflatoxin B1 decreases expression ISO CGN (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of CGN mRNA CTD PMID:27153756 Cgn Rat all-trans-retinoic acid increases expression ISO CGN (Homo sapiens) 6480464 Tretinoin results in increased expression of CGN mRNA CTD PMID:23830798 Cgn Rat all-trans-retinoic acid increases expression ISO Cgn (Mus musculus) 6480464 Tretinoin results in increased expression of CGN mRNA CTD PMID:36189433 Cgn Rat all-trans-retinoic acid multiple interactions ISO Cgn (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of CGN mRNA CTD PMID:36189433 Cgn Rat aristolochic acid A increases expression ISO CGN (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CGN mRNA CTD PMID:33212167 Cgn Rat arsane multiple interactions ISO CGN (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CGN mRNA CTD PMID:32525701 Cgn Rat arsenic atom multiple interactions ISO CGN (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CGN mRNA CTD PMID:32525701 Cgn Rat Benoxacor decreases expression ISO Cgn (Mus musculus) 6480464 benoxacor results in decreased expression of CGN mRNA CTD PMID:34850242 Cgn Rat benzo[a]pyrene decreases expression ISO Cgn (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CGN mRNA CTD PMID:19770486 Cgn Rat benzo[a]pyrene decreases methylation ISO CGN (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CGN 3' UTR and Benzo(a)pyrene results in decreased methylation of CGN 5' UTR CTD PMID:27901495 Cgn Rat benzo[a]pyrene decreases expression ISO CGN (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CGN mRNA CTD PMID:22316170 and PMID:31255691 Cgn Rat Benzo[k]fluoranthene decreases expression ISO Cgn (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of CGN mRNA CTD PMID:26377693 Cgn Rat bis(2-chloroethyl) sulfide increases expression ISO CGN (Homo sapiens) 6480464 Mustard Gas results in increased expression of CGN mRNA CTD PMID:25102026 Cgn Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CGN mRNA CTD PMID:25181051 and PMID:30816183 Cgn Rat bisphenol A increases expression ISO Cgn (Mus musculus) 6480464 bisphenol A results in increased expression of CGN mRNA CTD PMID:32156529 Cgn Rat bisphenol A decreases expression ISO CGN (Homo sapiens) 6480464 bisphenol A results in decreased expression of CGN protein CTD PMID:37567409 Cgn Rat bisphenol A decreases expression ISO Cgn (Mus musculus) 6480464 bisphenol A results in decreased expression of CGN mRNA CTD PMID:33221593 Cgn Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CGN mRNA CTD PMID:32145629 Cgn Rat bisphenol F increases expression ISO Cgn (Mus musculus) 6480464 bisphenol F results in increased expression of CGN mRNA CTD PMID:30951980 Cgn Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of CGN mRNA CTD PMID:24136188 Cgn Rat butanal increases expression ISO CGN (Homo sapiens) 6480464 butyraldehyde results in increased expression of CGN mRNA CTD PMID:26079696 Cgn Rat butyric acid multiple interactions EXP 6480464 Butyric Acid results in increased expression of and results in increased localization of CGN protein CTD PMID:15634758 Cgn Rat butyric acid increases expression EXP 6480464 Butyric Acid results in increased expression of CGN mRNA CTD PMID:15634758 Cgn Rat cadmium atom multiple interactions ISO Cgn (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CGN mRNA CTD PMID:37325564 Cgn Rat cadmium dichloride decreases expression ISO CGN (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CGN mRNA and Cadmium Chloride results in decreased expression of CGN protein CTD PMID:25851441 Cgn Rat cadmium dichloride multiple interactions ISO Cgn (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CGN mRNA CTD PMID:37325564 Cgn Rat caffeine decreases phosphorylation ISO CGN (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of CGN protein CTD PMID:35688186 Cgn Rat calcitriol increases expression ISO CGN (Homo sapiens) 6480464 Calcitriol results in increased expression of CGN mRNA CTD PMID:26485663 Cgn Rat carbon nanotube decreases expression ISO Cgn (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of CGN mRNA CTD PMID:25620056 Cgn Rat carbon nanotube increases expression ISO Cgn (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of CGN mRNA CTD PMID:25554681 Cgn Rat cisplatin multiple interactions ISO CGN (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of CGN mRNA CTD PMID:27392435 Cgn Rat cordycepin increases expression ISO Cgn (Mus musculus) 6480464 cordycepin results in increased expression of CGN mRNA CTD PMID:32042022 Cgn Rat coumestrol decreases expression ISO CGN (Homo sapiens) 6480464 Coumestrol results in decreased expression of CGN mRNA CTD PMID:19167446 Cgn Rat cyclosporin A decreases expression ISO CGN (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CGN mRNA CTD PMID:20106945 more ... Cgn Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of CGN mRNA CTD PMID:23153324 Cgn Rat dorsomorphin multiple interactions ISO CGN (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cgn Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CGN mRNA CTD PMID:29391264 Cgn Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of CGN mRNA CTD PMID:24793618 Cgn Rat FR900359 affects phosphorylation ISO CGN (Homo sapiens) 6480464 FR900359 affects the phosphorylation of CGN protein CTD PMID:37730182 Cgn Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CGN mRNA CTD PMID:33387578 Cgn Rat glyphosate decreases expression ISO Cgn (Mus musculus) 6480464 Glyphosate results in decreased expression of CGN protein CTD PMID:36173347 Cgn Rat inulin multiple interactions ISO Cgn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CGN mRNA CTD PMID:36331819 Cgn Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of CGN mRNA CTD PMID:24136188 Cgn Rat lipopolysaccharide multiple interactions ISO CGN (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CGN mRNA CTD PMID:35811015 Cgn Rat lipopolysaccharide increases expression ISO CGN (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of CGN mRNA CTD PMID:35811015 Cgn Rat methotrexate increases expression ISO CGN (Homo sapiens) 6480464 Methotrexate results in increased expression of CGN mRNA CTD PMID:21678067 Cgn Rat methylmercury chloride increases expression ISO CGN (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of CGN mRNA CTD PMID:26272509 Cgn Rat methylmercury chloride multiple interactions ISO CGN (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CGN mRNA CTD PMID:27188386 Cgn Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Cgn (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of CGN mRNA CTD PMID:36189433 Cgn Rat N-nitrosodiethylamine multiple interactions ISO Cgn (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of CGN gene CTD PMID:23968726 Cgn Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of CGN mRNA CTD PMID:24136188 Cgn Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of CGN mRNA CTD PMID:24136188 Cgn Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CGN mRNA CTD PMID:32479839 and PMID:33387578 Cgn Rat paracetamol decreases expression ISO CGN (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CGN mRNA CTD PMID:21420995 Cgn Rat pentanal increases expression ISO CGN (Homo sapiens) 6480464 pentanal results in increased expression of CGN mRNA CTD PMID:26079696 Cgn Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Cgn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CGN mRNA more ... CTD PMID:36331819 Cgn Rat phenobarbital decreases expression ISO Cgn (Mus musculus) 6480464 Phenobarbital results in decreased expression of CGN mRNA CTD PMID:19270015 Cgn Rat phenobarbital affects expression ISO CGN (Homo sapiens) 6480464 Phenobarbital affects the expression of CGN mRNA CTD PMID:19159669 Cgn Rat phenobarbital decreases expression ISO CGN (Homo sapiens) 6480464 Phenobarbital results in decreased expression of CGN mRNA CTD PMID:19084549 Cgn Rat phenylmercury acetate increases expression ISO CGN (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of CGN mRNA CTD PMID:26272509 Cgn Rat phenylmercury acetate multiple interactions ISO CGN (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CGN mRNA CTD PMID:27188386 Cgn Rat piperonyl butoxide multiple interactions ISO Cgn (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of CGN gene CTD PMID:23968726 Cgn Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Cgn (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of CGN mRNA CTD PMID:28903501 Cgn Rat propanal increases expression ISO CGN (Homo sapiens) 6480464 propionaldehyde results in increased expression of CGN mRNA CTD PMID:26079696 Cgn Rat rac-lactic acid decreases expression ISO CGN (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CGN mRNA CTD PMID:30851411 Cgn Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of CGN mRNA CTD PMID:28374803 Cgn Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CGN (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CGN mRNA CTD PMID:35811015 Cgn Rat SB 431542 increases expression ISO CGN (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of CGN protein CTD PMID:25670856 Cgn Rat SB 431542 multiple interactions ISO CGN (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Cgn Rat sodium arsenate multiple interactions ISO CGN (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CGN mRNA CTD PMID:32525701 Cgn Rat sodium arsenate increases expression ISO Cgn (Mus musculus) 6480464 sodium arsenate results in increased expression of CGN mRNA CTD PMID:30953684 Cgn Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of CGN protein CTD PMID:29459688 Cgn Rat sodium arsenite decreases expression ISO Cgn (Mus musculus) 6480464 sodium arsenite results in decreased expression of CGN mRNA CTD PMID:37682722 Cgn Rat tamoxifen decreases expression ISO Cgn (Mus musculus) 6480464 Tamoxifen results in decreased expression of CGN mRNA CTD PMID:25123088 Cgn Rat temozolomide increases expression ISO CGN (Homo sapiens) 6480464 Temozolomide results in increased expression of CGN mRNA CTD PMID:31758290 Cgn Rat testosterone increases expression ISO Cgn (Mus musculus) 6480464 Testosterone deficiency results in increased expression of CGN mRNA CTD PMID:33848595 Cgn Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CGN mRNA CTD PMID:31150632 Cgn Rat tetrachloromethane decreases expression ISO Cgn (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of CGN mRNA CTD PMID:31919559 Cgn Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CGN mRNA] CTD PMID:31150632 Cgn Rat tetraphene increases expression ISO Cgn (Mus musculus) 6480464 benz(a)anthracene results in increased expression of CGN mRNA CTD PMID:26377693 Cgn Rat thapsigargin decreases expression ISO CGN (Homo sapiens) 6480464 Thapsigargin results in decreased expression of CGN mRNA CTD PMID:29453283 Cgn Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CGN mRNA CTD PMID:34492290 Cgn Rat thiram increases expression ISO CGN (Homo sapiens) 6480464 Thiram results in increased expression of CGN mRNA CTD PMID:38568856 Cgn Rat titanium dioxide decreases methylation ISO Cgn (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CGN gene and titanium dioxide results in decreased methylation of CGN promoter CTD PMID:35295148 Cgn Rat titanium dioxide increases methylation ISO Cgn (Mus musculus) 6480464 titanium dioxide results in increased methylation of CGN gene CTD PMID:35295148 Cgn Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of CGN mRNA CTD PMID:33387578 Cgn Rat triclosan increases expression ISO CGN (Homo sapiens) 6480464 Triclosan results in increased expression of CGN mRNA CTD PMID:30510588 Cgn Rat triptonide decreases expression ISO Cgn (Mus musculus) 6480464 triptonide results in decreased expression of CGN mRNA CTD PMID:33045310 Cgn Rat valproic acid decreases methylation ISO CGN (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of CGN gene CTD PMID:29154799 Cgn Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of CGN protein CTD PMID:15634758 Cgn Rat valproic acid multiple interactions ISO CGN (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CGN mRNA CTD PMID:27188386 Cgn Rat valproic acid increases expression ISO CGN (Homo sapiens) 6480464 Valproic Acid results in increased expression of CGN mRNA CTD PMID:23179753 more ... Cgn Rat valproic acid affects expression ISO Cgn (Mus musculus) 6480464 Valproic Acid affects the expression of CGN mRNA CTD PMID:17963808 Cgn Rat vancomycin decreases expression ISO Cgn (Mus musculus) 6480464 Vancomycin results in decreased expression of CGN mRNA CTD PMID:18930951 Cgn Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of CGN mRNA CTD PMID:23869203 Cgn Rat vorinostat increases expression EXP 6480464 Vorinostat results in increased expression of CGN protein CTD PMID:15634758 Cgn Rat zoledronic acid decreases expression ISO CGN (Homo sapiens) 6480464 zoledronic acid results in decreased expression of CGN mRNA CTD PMID:24714768
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,3-dinitrobenzene (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 8-Br-cAMP (ISO) aconitine (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) Benoxacor (ISO) benzo[a]pyrene (ISO) Benzo[k]fluoranthene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buspirone (EXP) butanal (ISO) butyric acid (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) carbon nanotube (ISO) cisplatin (ISO) cordycepin (ISO) coumestrol (ISO) cyclosporin A (ISO) dieldrin (EXP) dorsomorphin (ISO) endosulfan (EXP) flutamide (EXP) FR900359 (ISO) gentamycin (EXP) glyphosate (ISO) inulin (ISO) levofloxacin (EXP) lipopolysaccharide (ISO) methotrexate (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N-nitrosodiethylamine (ISO) nefazodone (EXP) nimesulide (EXP) paracetamol (EXP,ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) piperonyl butoxide (ISO) pregnenolone 16alpha-carbonitrile (ISO) propanal (ISO) rac-lactic acid (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) tamoxifen (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) tetraphene (ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) triclosan (ISO) triptonide (ISO) valproic acid (EXP,ISO) vancomycin (ISO) vinclozolin (EXP) vorinostat (EXP) zoledronic acid (ISO)
Cgn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 184,997,425 - 185,024,785 (-) NCBI GRCr8 mRatBN7.2 2 182,308,389 - 182,335,747 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 182,308,714 - 182,334,645 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 2 195,909,691 - 195,937,130 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 195,909,626 - 195,935,878 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 215,388,309 - 215,415,608 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 189,645,082 - 189,670,491 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 189,598,427 - 189,623,829 (-) NCBI Celera 2 174,853,719 - 174,881,121 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
CGN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 151,510,170 - 151,538,692 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 151,510,510 - 151,538,692 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 151,483,863 - 151,511,168 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 149,750,497 - 149,777,792 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 148,296,945 - 148,324,238 NCBI Celera 1 124,599,109 - 124,626,467 (+) NCBI Celera Cytogenetic Map 1 q21.3 NCBI HuRef 1 122,861,357 - 122,888,539 (+) NCBI HuRef CHM1_1 1 152,879,286 - 152,906,583 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 150,633,864 - 150,662,396 (+) NCBI T2T-CHM13v2.0
Cgn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 94,667,376 - 94,695,036 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 94,667,376 - 94,693,826 (-) Ensembl GRCm39 Ensembl GRCm38 3 94,760,069 - 94,787,725 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 94,760,069 - 94,786,515 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 94,563,991 - 94,590,437 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 94,845,475 - 94,872,330 (-) NCBI MGSCv36 mm8 MGSCv36 3 95,007,645 - 95,079,570 (-) NCBI MGSCv36 mm8 Celera 3 93,088,294 - 93,088,956 (+) NCBI Celera Cytogenetic Map 3 F2.1 NCBI cM Map 3 40.74 NCBI
Cgn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955589 856,618 - 881,150 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955589 855,715 - 881,123 (-) NCBI ChiLan1.0 ChiLan1.0
CGN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 98,285,731 - 98,312,818 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 98,036,918 - 98,063,991 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 126,869,973 - 126,897,024 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 130,514,813 - 130,541,445 (+) NCBI panpan1.1 PanPan1.1 panPan2
CGN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 60,553,423 - 60,578,804 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 60,559,116 - 60,578,705 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 60,001,923 - 60,021,526 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 61,569,769 - 61,595,157 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 61,575,456 - 61,595,050 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 60,403,124 - 60,422,723 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 60,489,055 - 60,508,615 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 61,217,915 - 61,237,513 (+) NCBI UU_Cfam_GSD_1.0
Cgn
CGN
CGN
Cgn
.
Predicted Target Of
Count of predictions: 207 Count of miRNA genes: 159 Interacting mature miRNAs: 178 Transcripts: ENSRNOT00000028440, ENSRNOT00000066035 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
AI987749
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 182,308,435 - 182,308,557 (+) MAPPER mRatBN7.2 Rnor_6.0 2 195,909,738 - 195,909,859 NCBI Rnor6.0 Rnor_5.0 2 215,388,356 - 215,388,477 UniSTS Rnor5.0 RGSC_v3.4 2 189,643,880 - 189,644,001 UniSTS RGSC3.4 Celera 2 174,853,766 - 174,853,887 UniSTS Cytogenetic Map 2 q34 UniSTS
BI292144
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 182,314,352 - 182,314,565 (+) MAPPER mRatBN7.2 Rnor_6.0 2 195,915,655 - 195,915,867 NCBI Rnor6.0 Rnor_5.0 2 215,394,273 - 215,394,485 UniSTS Rnor5.0 RGSC_v3.4 2 189,649,797 - 189,650,009 UniSTS RGSC3.4 Celera 2 174,859,646 - 174,859,858 UniSTS RH 3.4 Map 2 1194.01 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028440 ⟹ ENSRNOP00000028440
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 182,308,714 - 182,327,759 (-) Ensembl Rnor_6.0 Ensembl 2 195,909,626 - 195,935,878 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101960 ⟹ ENSRNOP00000089863
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 182,323,888 - 182,334,645 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116247 ⟹ ENSRNOP00000085785
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 182,308,714 - 182,334,645 (-) Ensembl
RefSeq Acc Id:
NM_001427774 ⟹ NP_001414703
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 184,997,425 - 185,023,635 (-) NCBI
RefSeq Acc Id:
XM_006232928 ⟹ XP_006232990
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 184,997,425 - 185,023,478 (-) NCBI mRatBN7.2 2 182,308,389 - 182,334,424 (-) NCBI Rnor_6.0 2 195,909,691 - 195,935,769 (-) NCBI Rnor_5.0 2 215,388,309 - 215,415,608 (-) NCBI
Sequence:
TGCGATGCGGGTGAGCCCTCAGGAGTATGCCTGAGGGGCGGAGTGGAGGCATCAAATGCCCTCCTCCTGGGCACAGGTGCTGAGTTTAGGAGGAAGGGCGGTCAGAGTGCGGTGGCAGAACTACGGGC
hide sequence
RefSeq Acc Id:
XM_006232929 ⟹ XP_006232991
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 184,997,425 - 185,024,783 (-) NCBI mRatBN7.2 2 182,308,389 - 182,335,747 (-) NCBI Rnor_6.0 2 195,909,691 - 195,936,999 (-) NCBI Rnor_5.0 2 215,388,309 - 215,415,608 (-) NCBI
Sequence:
GGGAGGGGAAGGGAATGATCTCCAGCTAACGCCACGGAAATGCTAGCTGTATCGAAGATTCCTC
hide sequence
RefSeq Acc Id:
XM_063281870 ⟹ XP_063137940
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 185,007,265 - 185,024,785 (-) NCBI
RefSeq Acc Id:
XP_006232991 ⟸ XM_006232929
- Peptide Label:
isoform X1
- UniProtKB:
D4A4X4 (UniProtKB/TrEMBL), A0A8I6A4L9 (UniProtKB/TrEMBL)
- Sequence:
MMADPRGPVDHGVQIRFITEPEGAAEMGTLRRSGRRPAKDARASTYGVAVRVQGIAGQPFVVLNSGEKGADSFGVQIKGGNNRGSPGALSSDSELPENPYSQVKGYPATSQGSTSDEEPRDHLNGKLL
hide sequence
RefSeq Acc Id:
XP_006232990 ⟸ XM_006232928
- Peptide Label:
isoform X1
- UniProtKB:
D4A4X4 (UniProtKB/TrEMBL), A0A8I6A4L9 (UniProtKB/TrEMBL)
- Sequence:
MMADPRGPVDHGVQIRFITEPEGAAEMGTLRRSGRRPAKDARASTYGVAVRVQGIAGQPFVVLN
hide sequence
Ensembl Acc Id:
ENSRNOP00000028440 ⟸ ENSRNOT00000028440
Ensembl Acc Id:
ENSRNOP00000089863 ⟸ ENSRNOT00000101960
Ensembl Acc Id:
ENSRNOP00000085785 ⟸ ENSRNOT00000116247
RefSeq Acc Id:
NP_001414703 ⟸ NM_001427774
- UniProtKB:
D4A4X4 (UniProtKB/TrEMBL), A0A8I6A4L9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137940 ⟸ XM_063281870
- Peptide Label:
isoform X2
RGD ID: 13691529 Promoter ID: EPDNEW_R2053 Type: initiation region Name: Cgn_1 Description: cingulin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 195,935,901 - 195,935,961 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Cgn
cingulin
Cgn_predicted
cingulin (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Cgn_predicted
cingulin (predicted)
Symbol and Name status set to approved
70820 APPROVED
