Symbol:
Fhdc1
Name:
FH2 domain containing 1
RGD ID:
1311955
Description:
Predicted to enable actin binding activity and microtubule binding activity. Predicted to be involved in Golgi ribbon formation; actin filament organization; and cilium assembly. Predicted to be located in Golgi apparatus; cilium; and cytoplasmic microtubule. Predicted to be active in actin filament. Orthologous to human FHDC1 (FH2 domain containing 1); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
FH2 domain-containing protein 1; LOC295161; RGD1311955; similar to CG32384-PA
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FHDC1 (FH2 domain containing 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Fhdc1 (FH2 domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fhdc1 (FH2 domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FHDC1 (FH2 domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FHDC1 (FH2 domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fhdc1 (FH2 domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FHDC1 (FH2 domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FHDC1 (FH2 domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fhdc1 (FH2 domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
INF2 (inverted formin 2) HGNC
Panther
Homo sapiens (human):
PLPP5 (phospholipid phosphatase 5) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Fhdc1 (FH2 domain containing 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
FHDC1 (FH2 domain containing 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fhdc1 (FH2 domain containing 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
exc-6
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
form3
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
fhdc1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 172,088,987 - 172,127,838 (-) NCBI GRCr8 mRatBN7.2 2 169,790,917 - 169,829,580 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 169,790,947 - 169,827,896 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 176,970,048 - 177,006,978 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 174,989,950 - 175,026,878 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 169,591,466 - 169,628,394 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 183,450,608 - 183,487,820 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 183,450,619 - 183,487,820 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 202,860,601 - 202,896,104 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 176,220,901 - 176,258,572 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 176,171,034 - 176,203,931 (-) NCBI Celera 2 163,790,155 - 163,826,877 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fhdc1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of FHDC1 mRNA] CTD PMID:31150632 Fhdc1 Rat (1->4)-beta-D-glucan multiple interactions ISO Fhdc1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FHDC1 mRNA CTD PMID:36331819 Fhdc1 Rat 1,1-dichloroethene increases expression ISO Fhdc1 (Mus musculus) 6480464 vinylidene chloride results in increased expression of FHDC1 mRNA CTD PMID:26682919 Fhdc1 Rat 1,2-dimethylhydrazine decreases expression ISO Fhdc1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of FHDC1 mRNA CTD PMID:22206623 Fhdc1 Rat 17beta-estradiol increases expression ISO Fhdc1 (Mus musculus) 6480464 Estradiol results in increased expression of FHDC1 mRNA CTD PMID:39298647 Fhdc1 Rat 17beta-estradiol increases expression ISO FHDC1 (Homo sapiens) 6480464 Estradiol results in increased expression of FHDC1 mRNA CTD PMID:31614463 Fhdc1 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO FHDC1 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Fhdc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FHDC1 mRNA CTD PMID:22298810 Fhdc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FHDC1 mRNA CTD PMID:33387578 Fhdc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Fhdc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FHDC1 mRNA CTD PMID:26377647 Fhdc1 Rat 2-hydroxypropanoic acid decreases expression ISO FHDC1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of FHDC1 mRNA CTD PMID:30851411 Fhdc1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Fhdc1 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of FHDC1 mRNA CTD PMID:25172293 Fhdc1 Rat 4,4'-sulfonyldiphenol increases expression ISO FHDC1 (Homo sapiens) 6480464 bisphenol S results in increased expression of FHDC1 mRNA CTD PMID:27685785 Fhdc1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of FHDC1 mRNA CTD PMID:24780913 more ... Fhdc1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of FHDC1 mRNA CTD PMID:31881176 Fhdc1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FHDC1 mRNA CTD PMID:35163327 Fhdc1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of FHDC1 mRNA CTD PMID:30047161 Fhdc1 Rat aristolochic acid A increases expression ISO FHDC1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of FHDC1 mRNA CTD PMID:33212167 Fhdc1 Rat arsane affects methylation ISO FHDC1 (Homo sapiens) 6480464 Arsenic affects the methylation of FHDC1 gene CTD PMID:25304211 Fhdc1 Rat arsane multiple interactions ISO FHDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FHDC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FHDC1 mRNA CTD PMID:39836092 Fhdc1 Rat arsenic atom affects methylation ISO FHDC1 (Homo sapiens) 6480464 Arsenic affects the methylation of FHDC1 gene CTD PMID:25304211 Fhdc1 Rat arsenic atom multiple interactions ISO FHDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FHDC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FHDC1 mRNA CTD PMID:39836092 Fhdc1 Rat atrazine decreases expression ISO FHDC1 (Homo sapiens) 6480464 Atrazine results in decreased expression of FHDC1 mRNA CTD PMID:22378314 Fhdc1 Rat benzo[a]pyrene increases methylation ISO FHDC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of FHDC1 3' UTR CTD PMID:27901495 Fhdc1 Rat benzo[a]pyrene increases expression ISO FHDC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of FHDC1 mRNA CTD PMID:32234424 Fhdc1 Rat bis(2-ethylhexyl) phthalate increases methylation ISO Fhdc1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased methylation of FHDC1 exon and Diethylhexyl Phthalate results in increased methylation of FHDC1 intron CTD PMID:32864567 Fhdc1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FHDC1 mRNA CTD PMID:25181051 and PMID:32145629 Fhdc1 Rat cadmium atom multiple interactions ISO Fhdc1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FHDC1 mRNA CTD PMID:37325564 Fhdc1 Rat cadmium dichloride multiple interactions ISO Fhdc1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FHDC1 mRNA CTD PMID:37325564 Fhdc1 Rat carbamazepine affects expression ISO FHDC1 (Homo sapiens) 6480464 Carbamazepine affects the expression of FHDC1 mRNA CTD PMID:25979313 Fhdc1 Rat carbon nanotube decreases expression ISO Fhdc1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Fhdc1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of FHDC1 mRNA CTD PMID:18500788 Fhdc1 Rat choline multiple interactions ISO Fhdc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FHDC1 gene CTD PMID:20938992 Fhdc1 Rat cyclosporin A increases expression ISO FHDC1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of FHDC1 mRNA CTD PMID:27989131 Fhdc1 Rat Dibutyl phosphate affects expression ISO FHDC1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of FHDC1 mRNA CTD PMID:37042841 Fhdc1 Rat Didecyldimethylammonium decreases expression ISO FHDC1 (Homo sapiens) 6480464 didecyldimethylammonium results in decreased expression of FHDC1 mRNA CTD PMID:32763356 Fhdc1 Rat dioxygen multiple interactions ISO Fhdc1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of FHDC1 mRNA CTD PMID:30529165 Fhdc1 Rat dorsomorphin multiple interactions ISO FHDC1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FHDC1 mRNA CTD PMID:27188386 Fhdc1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of FHDC1 mRNA CTD PMID:29391264 Fhdc1 Rat folic acid multiple interactions ISO Fhdc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FHDC1 gene CTD PMID:20938992 Fhdc1 Rat L-methionine multiple interactions ISO Fhdc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FHDC1 gene CTD PMID:20938992 Fhdc1 Rat manganese atom multiple interactions ISO FHDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FHDC1 mRNA CTD PMID:39836092 Fhdc1 Rat manganese(0) multiple interactions ISO FHDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FHDC1 mRNA CTD PMID:39836092 Fhdc1 Rat manganese(II) chloride multiple interactions ISO FHDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FHDC1 mRNA CTD PMID:39836092 Fhdc1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of FHDC1 mRNA CTD PMID:30047161 Fhdc1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of FHDC1 gene CTD PMID:35440735 Fhdc1 Rat microcystin-LR increases methylation ISO FHDC1 (Homo sapiens) 6480464 cyanoginosin LR results in increased methylation of FHDC1 gene CTD PMID:29518473 Fhdc1 Rat microcystin-LR decreases expression ISO FHDC1 (Homo sapiens) 6480464 cyanoginosin LR results in decreased expression of FHDC1 mRNA CTD PMID:29518473 Fhdc1 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of FHDC1 mRNA CTD PMID:25729387 Fhdc1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of FHDC1 mRNA CTD PMID:25729387 Fhdc1 Rat ozone multiple interactions ISO FHDC1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of FHDC1 mRNA CTD PMID:35430440 Fhdc1 Rat paracetamol increases expression ISO FHDC1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of FHDC1 mRNA CTD PMID:29067470 Fhdc1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of FHDC1 mRNA CTD PMID:33387578 Fhdc1 Rat perfluorohexanesulfonic acid decreases expression ISO Fhdc1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of FHDC1 mRNA CTD PMID:37995155 Fhdc1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Fhdc1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FHDC1 mRNA CTD PMID:36331819 Fhdc1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FHDC1 mRNA CTD PMID:35163327 Fhdc1 Rat pirinixic acid increases expression ISO Fhdc1 (Mus musculus) 6480464 pirinixic acid results in increased expression of FHDC1 mRNA CTD PMID:17426115 and PMID:23811191 Fhdc1 Rat potassium chromate decreases expression ISO FHDC1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of FHDC1 mRNA CTD PMID:22714537 Fhdc1 Rat rac-lactic acid decreases expression ISO FHDC1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of FHDC1 mRNA CTD PMID:30851411 Fhdc1 Rat resveratrol multiple interactions ISO FHDC1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of FHDC1 mRNA CTD PMID:23557933 Fhdc1 Rat roxarsone decreases expression ISO FHDC1 (Homo sapiens) 6480464 Roxarsone results in decreased expression of INF1 mRNA CTD PMID:18414637 Fhdc1 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO FHDC1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of FHDC1 mRNA CTD PMID:33725128 Fhdc1 Rat SB 431542 multiple interactions ISO FHDC1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FHDC1 mRNA CTD PMID:27188386 Fhdc1 Rat sodium arsenite multiple interactions ISO FHDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FHDC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FHDC1 mRNA CTD PMID:39836092 Fhdc1 Rat sodium arsenite decreases expression ISO Fhdc1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of FHDC1 mRNA CTD PMID:37682722 Fhdc1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of FHDC1 mRNA CTD PMID:30047161 Fhdc1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of FHDC1 mRNA] CTD PMID:31150632 Fhdc1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of FHDC1 mRNA CTD PMID:31150632 Fhdc1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of FHDC1 mRNA CTD PMID:34492290 Fhdc1 Rat titanium dioxide decreases expression ISO Fhdc1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of FHDC1 mRNA CTD PMID:23557971 Fhdc1 Rat titanium dioxide decreases methylation ISO Fhdc1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of FHDC1 promoter CTD PMID:35295148 Fhdc1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of FHDC1 mRNA CTD PMID:25729387 Fhdc1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of FHDC1 mRNA CTD PMID:25729387 Fhdc1 Rat triphenyl phosphate affects expression ISO FHDC1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of FHDC1 mRNA CTD PMID:37042841 Fhdc1 Rat troglitazone decreases expression ISO Fhdc1 (Mus musculus) 6480464 troglitazone results in decreased expression of FHDC1 mRNA CTD PMID:28973697 Fhdc1 Rat urethane increases expression ISO FHDC1 (Homo sapiens) 6480464 Urethane results in increased expression of FHDC1 mRNA CTD PMID:28818685 Fhdc1 Rat valproic acid affects expression ISO Fhdc1 (Mus musculus) 6480464 Valproic Acid affects the expression of FHDC1 mRNA CTD PMID:17963808 Fhdc1 Rat valproic acid affects expression ISO FHDC1 (Homo sapiens) 6480464 Valproic Acid affects the expression of FHDC1 mRNA CTD PMID:25979313 Fhdc1 Rat valproic acid increases expression ISO FHDC1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of FHDC1 mRNA CTD PMID:26272509 Fhdc1 Rat valproic acid multiple interactions ISO FHDC1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FHDC1 mRNA CTD PMID:27188386 Fhdc1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of FHDC1 gene CTD PMID:31079544
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) alpha-Zearalanol (EXP) amitrole (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (ISO) cefaloridine (EXP) choline (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) Didecyldimethylammonium (ISO) dioxygen (ISO) dorsomorphin (ISO) endosulfan (EXP) folic acid (ISO) L-methionine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (EXP) methoxychlor (EXP) microcystin-LR (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) pirinixic acid (ISO) potassium chromate (ISO) rac-lactic acid (ISO) resveratrol (ISO) roxarsone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Fhdc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 172,088,987 - 172,127,838 (-) NCBI GRCr8 mRatBN7.2 2 169,790,917 - 169,829,580 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 169,790,947 - 169,827,896 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 176,970,048 - 177,006,978 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 174,989,950 - 175,026,878 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 169,591,466 - 169,628,394 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 183,450,608 - 183,487,820 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 183,450,619 - 183,487,820 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 202,860,601 - 202,896,104 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 176,220,901 - 176,258,572 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 176,171,034 - 176,203,931 (-) NCBI Celera 2 163,790,155 - 163,826,877 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
FHDC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 152,911,339 - 152,979,671 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 152,936,323 - 152,979,671 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 153,857,475 - 153,900,823 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 154,083,585 - 154,120,298 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 4 151,189,210 - 151,225,925 (+) NCBI Celera Cytogenetic Map 4 q31.3 NCBI HuRef 4 149,590,362 - 149,627,026 (+) NCBI HuRef CHM1_1 4 153,842,131 - 153,878,844 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 156,234,537 - 156,302,882 (+) NCBI T2T-CHM13v2.0
Fhdc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 84,349,503 - 84,387,746 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 84,349,505 - 84,387,736 (-) Ensembl GRCm39 Ensembl GRCm38 3 84,442,191 - 84,480,439 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 84,442,198 - 84,480,429 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 84,247,947 - 84,284,351 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 84,529,965 - 84,566,356 (-) NCBI MGSCv36 mm8 Celera 3 84,454,439 - 84,490,446 (-) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 37.67 NCBI
Fhdc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955471 7,368,086 - 7,399,431 (+) NCBI ChiLan1.0 ChiLan1.0
FHDC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 150,799,452 - 150,866,199 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 151,157,379 - 151,221,645 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 145,252,573 - 145,320,558 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 156,925,332 - 156,969,033 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 156,932,390 - 156,966,068 (+) Ensembl panpan1.1 panPan2
FHDC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 50,775,989 - 50,818,188 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 50,775,431 - 50,815,844 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 51,122,567 - 51,164,880 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 51,462,577 - 51,504,908 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 51,469,943 - 51,504,911 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 50,721,559 - 50,761,584 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 50,825,389 - 50,864,084 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 51,136,361 - 51,177,706 (+) NCBI UU_Cfam_GSD_1.0
Fhdc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 39,694,918 - 39,732,306 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936689 2,803,739 - 2,838,255 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936689 2,803,714 - 2,836,903 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FHDC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 76,106,192 - 76,148,319 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 76,103,631 - 76,148,690 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 80,673,505 - 80,716,853 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FHDC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 99,489,395 - 99,531,571 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 99,497,326 - 99,534,096 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 79,140,692 - 79,182,217 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fhdc1
.
Predicted Target Of
Count of predictions: 279 Count of miRNA genes: 188 Interacting mature miRNAs: 206 Transcripts: ENSRNOT00000066477 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 6907363 Bp357 Blood pressure QTL 357 4.1 0.002 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 129540907 174540907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 12879845 Cm89 Cardiac mass QTL 89 0.008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 175950118 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 12879846 Cm90 Cardiac mass QTL 90 0.011 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 2 152413072 175950118 Rat 12879847 Am4 Aortic mass QTL 4 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 175950118 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2301415 Cm67 Cardiac mass QTL 67 0.003 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 175950118 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 11565180 Kidm56 Kidney mass QTL 56 0.003 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 175950118 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 11565181 Bw176 Body weight QTL 176 0.002 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 175950118 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat
BE101878
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 169,829,825 - 169,830,024 (+) MAPPER mRatBN7.2 Rnor_6.0 2 183,489,265 - 183,489,463 NCBI Rnor6.0 Rnor_5.0 2 202,897,620 - 202,897,818 UniSTS Rnor5.0 RGSC_v3.4 2 176,260,010 - 176,260,208 UniSTS RGSC3.4 Celera 2 163,828,381 - 163,828,579 UniSTS RH 3.4 Map 2 1107.2 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066477 ⟹ ENSRNOP00000060810
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 169,790,947 - 169,827,896 (-) Ensembl Rnor_6.0 Ensembl 2 183,450,619 - 183,487,820 (-) Ensembl
RefSeq Acc Id:
NM_001106437 ⟹ NP_001099907
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 172,088,997 - 172,125,956 (-) NCBI mRatBN7.2 2 169,790,934 - 169,827,896 (-) NCBI Rnor_6.0 2 183,450,608 - 183,487,820 (-) NCBI Rnor_5.0 2 202,860,601 - 202,896,104 (-) NCBI RGSC_v3.4 2 176,220,901 - 176,258,572 (-) RGD Celera 2 163,790,155 - 163,826,877 (-) RGD
Sequence:
GGACCGCCCATTCGGAGCTCGCTTGCTGTCCCGGGATCCTGGGCTGCTCGACTGCCGGACGCTAGTGGCCTTGCGGGGGGCTTGGGCTAAGCGCAGCTAGAGCCGGCGGAGCCAAGGGCCTTTTGGTC
hide sequence
RefSeq Acc Id:
XM_039102025 ⟹ XP_038957953
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 172,088,987 - 172,127,838 (-) NCBI mRatBN7.2 2 169,790,917 - 169,829,580 (-) NCBI
RefSeq Acc Id:
NP_001099907 ⟸ NM_001106437
- UniProtKB:
D3ZL83 (UniProtKB/TrEMBL), A6J5W7 (UniProtKB/TrEMBL)
- Sequence:
MHVMNCVSLAGDKENGTLATAAAFMTGQTSPSASPAPPPPPPPPPPCPHSGEGFPPSPPPPLPPPLPGGPPVPPPPPGLPPASYLNGYSSLGKKKRMRSFFWKTIPEEQVRGKTNIWTLAAKQQHHYQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000060810 ⟸ ENSRNOT00000066477
RefSeq Acc Id:
XP_038957953 ⟸ XM_039102025
- Peptide Label:
isoform X1
- UniProtKB:
D3ZL83 (UniProtKB/TrEMBL), A6J5W7 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-27
Fhdc1
FH2 domain containing 1
RGD1311955_predicted
similar to CG32384-PA (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
RGD1311955_predicted
similar to CG32384-PA (predicted)
LOC295161_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC295161_predicted
similar to CG32384-PA (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
