Symbol:
Ptgr2
Name:
prostaglandin reductase 2
RGD ID:
1310518
Description:
Predicted to enable 15-oxoprostaglandin 13-oxidase [NAD(P)+] activity. Predicted to be involved in prostaglandin metabolic process. Predicted to be located in cytoplasm. Orthologous to human PTGR2 (prostaglandin reductase 2); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
15-oxoprostaglandin 13-reductase; LOC299194; MGC108784; PRG-2; Zadh1; zinc binding alcohol dehydrogenase, domain containing 1; zinc-binding alcohol dehydrogenase domain-containing protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 109,662,469 - 109,694,232 (+) NCBI GRCr8 mRatBN7.2 6 103,931,367 - 103,963,113 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 103,931,409 - 103,963,111 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 104,093,166 - 104,124,901 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 104,392,251 - 104,423,987 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 103,761,828 - 103,793,565 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 107,999,832 - 108,031,645 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 107,999,846 - 108,031,643 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 117,514,752 - 117,546,565 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 108,349,172 - 108,380,867 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 108,352,627 - 108,384,321 (+) NCBI Celera 6 101,759,837 - 101,791,510 (+) NCBI Celera Cytogenetic Map 6 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ptgr2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PTGR2 mRNA] CTD PMID:31150632 Ptgr2 Rat 1,1-dichloroethene decreases expression ISO Ptgr2 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of PTGR2 mRNA CTD PMID:26682919 Ptgr2 Rat 1,2-dimethylhydrazine decreases expression ISO Ptgr2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PTGR2 mRNA CTD PMID:22206623 Ptgr2 Rat 17alpha-ethynylestradiol multiple interactions ISO Ptgr2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PTGR2 mRNA CTD PMID:17942748 Ptgr2 Rat 17beta-estradiol decreases expression ISO Ptgr2 (Mus musculus) 6480464 Estradiol results in decreased expression of PTGR2 mRNA CTD PMID:39298647 Ptgr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ptgr2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PTGR2 mRNA CTD PMID:15328365 Ptgr2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ptgr2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PTGR2 mRNA CTD PMID:17942748 Ptgr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PTGR2 mRNA CTD PMID:22808131 Ptgr2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PTGR2 mRNA CTD PMID:21346803 Ptgr2 Rat 4-hydroxyphenyl retinamide decreases expression ISO Ptgr2 (Mus musculus) 6480464 Fenretinide results in decreased expression of PTGR2 mRNA CTD PMID:28973697 Ptgr2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PTGR2 mRNA CTD PMID:30047161 Ptgr2 Rat acrylamide increases expression ISO PTGR2 (Homo sapiens) 6480464 Acrylamide results in increased expression of PTGR2 mRNA CTD PMID:32763439 Ptgr2 Rat aflatoxin B1 increases methylation ISO PTGR2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PTGR2 intron CTD PMID:30157460 Ptgr2 Rat aflatoxin B1 increases expression ISO PTGR2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PTGR2 mRNA CTD PMID:21632981 Ptgr2 Rat Aflatoxin B2 alpha decreases methylation ISO PTGR2 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of PTGR2 intron CTD PMID:30157460 Ptgr2 Rat all-trans-retinoic acid decreases expression ISO PTGR2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PTGR2 mRNA CTD PMID:33167477 Ptgr2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PTGR2 mRNA CTD PMID:30047161 Ptgr2 Rat arsane multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PTGR2 mRNA CTD PMID:39836092 Ptgr2 Rat arsenic atom multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PTGR2 mRNA CTD PMID:39836092 Ptgr2 Rat benzo[a]pyrene increases expression ISO PTGR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PTGR2 mRNA CTD PMID:20106945 and PMID:21632981 Ptgr2 Rat benzo[a]pyrene increases expression ISO Ptgr2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PTGR2 mRNA CTD PMID:22228805 Ptgr2 Rat beta-lapachone decreases expression ISO PTGR2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PTGR2 mRNA CTD PMID:38218311 Ptgr2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PTGR2 mRNA CTD PMID:25181051 Ptgr2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PTGR2 mRNA CTD PMID:30816183 and PMID:32528016 Ptgr2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PTGR2 gene CTD PMID:28505145 Ptgr2 Rat bisphenol F increases expression ISO Ptgr2 (Mus musculus) 6480464 bisphenol F results in increased expression of PTGR2 mRNA CTD PMID:38685157 Ptgr2 Rat butan-1-ol multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of PTGR2 mRNA CTD PMID:29432896 Ptgr2 Rat butanal decreases expression ISO PTGR2 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PTGR2 mRNA CTD PMID:26079696 Ptgr2 Rat caffeine decreases phosphorylation ISO PTGR2 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PTGR2 protein CTD PMID:35688186 Ptgr2 Rat carbon nanotube decreases expression ISO Ptgr2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Ptgr2 Rat CGP 52608 multiple interactions ISO PTGR2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PTGR2 gene] CTD PMID:28238834 Ptgr2 Rat chlorpyrifos decreases expression ISO Ptgr2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PTGR2 mRNA CTD PMID:37019170 Ptgr2 Rat choline multiple interactions ISO Ptgr2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PTGR2 gene CTD PMID:20938992 Ptgr2 Rat cisplatin increases expression ISO PTGR2 (Homo sapiens) 6480464 Cisplatin results in increased expression of PTGR2 mRNA CTD PMID:27392435 Ptgr2 Rat cisplatin multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PTGR2 mRNA CTD PMID:27392435 Ptgr2 Rat copper atom multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of PTGR2 mRNA CTD PMID:20971185 Ptgr2 Rat copper(0) multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of PTGR2 mRNA CTD PMID:20971185 Ptgr2 Rat cyclosporin A decreases expression ISO Ptgr2 (Mus musculus) 6480464 Cyclosporine results in decreased expression of PTGR2 mRNA CTD PMID:19770486 Ptgr2 Rat cyclosporin A decreases expression ISO PTGR2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PTGR2 mRNA CTD PMID:20106945 Ptgr2 Rat dorsomorphin multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ptgr2 Rat doxorubicin decreases expression ISO PTGR2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PTGR2 mRNA CTD PMID:29803840 Ptgr2 Rat entinostat increases expression ISO PTGR2 (Homo sapiens) 6480464 entinostat results in increased expression of PTGR2 mRNA CTD PMID:27188386 Ptgr2 Rat enzyme inhibitor multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PTGR2 protein CTD PMID:23301498 Ptgr2 Rat ethanol affects expression ISO Ptgr2 (Mus musculus) 6480464 Ethanol affects the expression of PTGR2 mRNA CTD PMID:30319688 Ptgr2 Rat ethanol increases expression ISO Ptgr2 (Mus musculus) 6480464 Ethanol results in increased expression of PTGR2 mRNA CTD PMID:30319688 Ptgr2 Rat ethyl methanesulfonate decreases expression ISO PTGR2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of PTGR2 mRNA CTD PMID:23649840 Ptgr2 Rat fenthion decreases expression ISO Ptgr2 (Mus musculus) 6480464 Fenthion results in decreased expression of PTGR2 mRNA CTD PMID:34813904 Ptgr2 Rat folic acid multiple interactions ISO Ptgr2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PTGR2 gene CTD PMID:20938992 Ptgr2 Rat folic acid decreases expression ISO Ptgr2 (Mus musculus) 6480464 Folic Acid results in decreased expression of PTGR2 mRNA CTD PMID:25629700 Ptgr2 Rat formaldehyde decreases expression ISO PTGR2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PTGR2 mRNA CTD PMID:23649840 Ptgr2 Rat genistein increases expression ISO PTGR2 (Homo sapiens) 6480464 Genistein results in increased expression of PTGR2 protein CTD PMID:20884965 Ptgr2 Rat genistein multiple interactions ISO PTGR2 (Homo sapiens) 6480464 ESR2 promotes the reaction [Genistein results in increased expression of PTGR2 protein] CTD PMID:20884965 Ptgr2 Rat gold atom decreases expression ISO PTGR2 (Homo sapiens) 6480464 Gold results in decreased expression of PTGR2 mRNA CTD PMID:25523186 Ptgr2 Rat gold(0) decreases expression ISO PTGR2 (Homo sapiens) 6480464 Gold results in decreased expression of PTGR2 mRNA CTD PMID:25523186 Ptgr2 Rat hydrogen peroxide decreases expression ISO PTGR2 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of PTGR2 mRNA CTD PMID:18951874 Ptgr2 Rat hydroquinone decreases expression ISO PTGR2 (Homo sapiens) 6480464 hydroquinone results in decreased expression of PTGR2 mRNA CTD PMID:31256213 Ptgr2 Rat L-methionine multiple interactions ISO Ptgr2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PTGR2 gene CTD PMID:20938992 Ptgr2 Rat manganese atom multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PTGR2 mRNA CTD PMID:39836092 Ptgr2 Rat manganese(0) multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PTGR2 mRNA CTD PMID:39836092 Ptgr2 Rat manganese(II) chloride multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PTGR2 mRNA CTD PMID:39836092 Ptgr2 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of PTGR2 mRNA CTD PMID:30467583 Ptgr2 Rat methidathion affects expression ISO Ptgr2 (Mus musculus) 6480464 methidathion affects the expression of PTGR2 mRNA CTD PMID:34813904 Ptgr2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PTGR2 mRNA CTD PMID:30047161 Ptgr2 Rat methyl methanesulfonate decreases expression ISO PTGR2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PTGR2 mRNA CTD PMID:23649840 Ptgr2 Rat methylmercury chloride decreases expression ISO PTGR2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PTGR2 mRNA CTD PMID:23179753 and PMID:27188386 Ptgr2 Rat paracetamol increases expression ISO PTGR2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PTGR2 mRNA CTD PMID:22230336 Ptgr2 Rat paracetamol affects expression ISO Ptgr2 (Mus musculus) 6480464 Acetaminophen affects the expression of PTGR2 mRNA CTD PMID:17562736 Ptgr2 Rat pirinixic acid increases expression ISO Ptgr2 (Mus musculus) 6480464 pirinixic acid results in increased expression of PTGR2 mRNA CTD PMID:17426115 and PMID:18301758 Ptgr2 Rat pirinixic acid decreases expression ISO Ptgr2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of PTGR2 mRNA CTD PMID:18445702 Ptgr2 Rat progesterone increases expression ISO PTGR2 (Homo sapiens) 6480464 Progesterone results in increased expression of PTGR2 mRNA CTD PMID:18037150 Ptgr2 Rat propiconazole decreases expression ISO Ptgr2 (Mus musculus) 6480464 propiconazole results in decreased expression of PTGR2 mRNA CTD PMID:21278054 Ptgr2 Rat quercetin increases expression ISO PTGR2 (Homo sapiens) 6480464 Quercetin results in increased expression of PTGR2 mRNA CTD PMID:21632981 Ptgr2 Rat SB 431542 multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ptgr2 Rat silicon dioxide decreases expression ISO PTGR2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PTGR2 mRNA CTD PMID:25895662 Ptgr2 Rat sodium arsenite multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PTGR2 mRNA CTD PMID:39836092 Ptgr2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PTGR2 mRNA CTD PMID:30047161 Ptgr2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PTGR2 mRNA] CTD PMID:31150632 Ptgr2 Rat tetrachloromethane decreases expression ISO Ptgr2 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PTGR2 mRNA CTD PMID:31919559 Ptgr2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PTGR2 mRNA CTD PMID:31150632 Ptgr2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PTGR2 mRNA CTD PMID:34492290 Ptgr2 Rat titanium dioxide affects expression ISO Ptgr2 (Mus musculus) 6480464 titanium dioxide affects the expression of PTGR2 mRNA CTD PMID:17656681 Ptgr2 Rat trichostatin A decreases expression ISO PTGR2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of PTGR2 mRNA CTD PMID:26272509 Ptgr2 Rat trichostatin A multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PTGR2 mRNA CTD PMID:27188386 Ptgr2 Rat triptonide affects expression ISO Ptgr2 (Mus musculus) 6480464 triptonide affects the expression of PTGR2 mRNA CTD PMID:33045310 Ptgr2 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of PTGR2 mRNA CTD PMID:24136188 Ptgr2 Rat urethane decreases expression ISO PTGR2 (Homo sapiens) 6480464 Urethane results in decreased expression of PTGR2 mRNA CTD PMID:28818685 Ptgr2 Rat valproic acid increases expression ISO PTGR2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PTGR2 mRNA CTD PMID:23527032 Ptgr2 Rat valproic acid decreases methylation ISO PTGR2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PTGR2 gene CTD PMID:29154799 Ptgr2 Rat valproic acid decreases expression ISO PTGR2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PTGR2 mRNA CTD PMID:23179753 more ... Ptgr2 Rat valproic acid multiple interactions ISO PTGR2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PTGR2 mRNA CTD PMID:27188386 Ptgr2 Rat vincristine decreases expression ISO PTGR2 (Homo sapiens) 6480464 Vincristine results in decreased expression of PTGR2 mRNA CTD PMID:23649840 Ptgr2 Rat zearalenone decreases expression ISO Ptgr2 (Mus musculus) 6480464 Zearalenone results in decreased expression of PTGR2 protein CTD PMID:36252740
Ptgr2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 109,662,469 - 109,694,232 (+) NCBI GRCr8 mRatBN7.2 6 103,931,367 - 103,963,113 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 103,931,409 - 103,963,111 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 104,093,166 - 104,124,901 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 104,392,251 - 104,423,987 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 103,761,828 - 103,793,565 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 107,999,832 - 108,031,645 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 107,999,846 - 108,031,643 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 117,514,752 - 117,546,565 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 108,349,172 - 108,380,867 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 108,352,627 - 108,384,321 (+) NCBI Celera 6 101,759,837 - 101,791,510 (+) NCBI Celera Cytogenetic Map 6 q31 NCBI
PTGR2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 73,851,831 - 73,885,726 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 73,851,831 - 73,885,726 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 74,318,534 - 74,352,429 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 73,388,424 - 73,421,915 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 73,388,426 - 73,421,915 NCBI Celera 14 54,355,472 - 54,389,115 (+) NCBI Celera Cytogenetic Map 14 q24.3 NCBI HuRef 14 54,485,578 - 54,519,224 (+) NCBI HuRef CHM1_1 14 74,258,185 - 74,291,756 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 68,059,477 - 68,093,373 (+) NCBI T2T-CHM13v2.0
Ptgr2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 84,332,011 - 84,362,606 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 84,332,006 - 84,362,606 (+) Ensembl GRCm39 Ensembl GRCm38 12 84,285,237 - 84,315,832 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 84,285,232 - 84,315,832 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 85,626,264 - 85,656,782 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 85,175,062 - 85,205,580 (+) NCBI MGSCv36 mm8 Celera 12 85,740,324 - 85,770,857 (+) NCBI Celera Cytogenetic Map 12 D1 NCBI cM Map 12 39.14 NCBI
Ptgr2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955523 1,515,017 - 1,549,998 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955523 1,519,767 - 1,549,998 (-) NCBI ChiLan1.0 ChiLan1.0
PTGR2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 74,941,609 - 74,981,970 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 74,158,124 - 74,191,783 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 54,410,939 - 54,444,595 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 73,266,484 - 73,299,378 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 73,266,502 - 73,299,378 (+) Ensembl panpan1.1 panPan2
PTGR2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 47,095,405 - 47,120,371 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 46,768,242 - 46,805,297 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 47,313,084 - 47,350,058 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 47,312,781 - 47,350,047 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 46,980,670 - 47,017,709 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 46,998,391 - 47,035,732 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 47,389,163 - 47,426,127 (+) NCBI UU_Cfam_GSD_1.0
Ptgr2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 28,903,412 - 28,945,624 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936488 3,123,304 - 3,166,863 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936488 3,123,405 - 3,165,556 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PTGR2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 97,174,219 - 97,195,595 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 97,174,143 - 97,195,601 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 102,928,733 - 102,950,202 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PTGR2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 51,060,503 - 51,095,762 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 51,060,608 - 51,095,303 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 39,274,452 - 39,312,455 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ptgr2
.
Predicted Target Of
Count of predictions: 703 Count of miRNA genes: 265 Interacting mature miRNAs: 322 Transcripts: ENSRNOT00000058095, ENSRNOT00000059073 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 1331722 Thshl1 Thyroid stimulating hormone level QTL 1 11.7 0.0001 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 6 89762877 106752806 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000058095 ⟹ ENSRNOP00000054903
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 103,931,423 - 103,963,111 (+) Ensembl Rnor_6.0 Ensembl 6 107,999,846 - 108,031,643 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000059073 ⟹ ENSRNOP00000055851
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 103,931,409 - 103,958,273 (+) Ensembl Rnor_6.0 Ensembl 6 108,009,251 - 108,029,859 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118264 ⟹ ENSRNOP00000080851
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 103,931,409 - 103,963,079 (+) Ensembl
RefSeq Acc Id:
NM_001015009 ⟹ NP_001015009
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,662,498 - 109,694,232 (+) NCBI mRatBN7.2 6 103,931,379 - 103,963,113 (+) NCBI Rnor_6.0 6 107,999,846 - 108,031,645 (+) NCBI Rnor_5.0 6 117,514,752 - 117,546,565 (-) NCBI RGSC_v3.4 6 108,349,172 - 108,380,867 (+) RGD Celera 6 101,759,837 - 101,791,510 (+) RGD
Sequence:
GAAGCCGGCAAAAAAGGAGGAAGTTTCAAGCCAGGGTGACCTGTGGGCGTCCTCGTCGAGCTCCCGGCGACACCGGCGGTATAGCTTGGGACGTAGACTAGGGGTTGCCCAGTAACAGGAATTATTTT
hide sequence
RefSeq Acc Id:
NM_001399426 ⟹ NP_001386355
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,662,498 - 109,694,232 (+) NCBI mRatBN7.2 6 103,931,379 - 103,963,113 (+) NCBI
RefSeq Acc Id:
NM_001399433 ⟹ NP_001386362
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,662,498 - 109,694,232 (+) NCBI mRatBN7.2 6 103,931,379 - 103,963,113 (+) NCBI
RefSeq Acc Id:
NR_174185
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,662,498 - 109,694,232 (+) NCBI mRatBN7.2 6 103,931,379 - 103,963,113 (+) NCBI
RefSeq Acc Id:
NR_174186
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,662,498 - 109,694,232 (+) NCBI mRatBN7.2 6 103,931,379 - 103,963,113 (+) NCBI
RefSeq Acc Id:
XM_006240327 ⟹ XP_006240389
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,662,469 - 109,694,156 (+) NCBI mRatBN7.2 6 103,931,367 - 103,963,113 (+) NCBI Rnor_6.0 6 107,999,835 - 108,031,645 (+) NCBI Rnor_5.0 6 117,514,752 - 117,546,565 (-) NCBI
Sequence:
GGAAGCTGGATGAAGCCGGCAAAAAAGGAGGAAGTTTCAAGCCAGGGTGACCTGTGGGCGTCCT
hide sequence
RefSeq Acc Id:
XM_006240329 ⟹ XP_006240391
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,674,256 - 109,694,156 (+) NCBI mRatBN7.2 6 103,943,200 - 103,963,113 (+) NCBI Rnor_6.0 6 108,011,662 - 108,031,645 (+) NCBI Rnor_5.0 6 117,514,752 - 117,546,565 (-) NCBI
Sequence:
AGCAAAGACAAAAACAAACAAACAAAAAAACTGTGGAAAAATGCGGTTAATGAAGTTCTTCCAAAAGCTTTAAGGTAGTAAAAATAATATGAAAAATTCTCAAATGGGGCTGTGAGATAGCTCAGGGA
hide sequence
RefSeq Acc Id:
XM_039112026 ⟹ XP_038967954
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,662,496 - 109,684,476 (+) NCBI mRatBN7.2 6 103,931,402 - 103,953,433 (+) NCBI
RefSeq Acc Id:
XM_063261733 ⟹ XP_063117803
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,662,497 - 109,694,156 (+) NCBI
RefSeq Acc Id:
XM_063261734 ⟹ XP_063117804
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,662,497 - 109,694,156 (+) NCBI
RefSeq Acc Id:
XM_063261735 ⟹ XP_063117805
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,662,469 - 109,694,156 (+) NCBI
RefSeq Acc Id:
NP_001015009 ⟸ NM_001015009
- Peptide Label:
isoform 2
- UniProtKB:
Q5BK81 (UniProtKB/Swiss-Prot)
- Sequence:
MIIQRVVLDSRPGKNGNPVAENFRVEEVSLPDTINEGQVRVRTLYLSVDPYMRCKMNEETGADYLAPWQLAQVADGGGLGVIEESKHQKLAKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSY
hide sequence
RefSeq Acc Id:
XP_006240389 ⟸ XM_006240327
- Peptide Label:
isoform X1
- UniProtKB:
Q5BK81 (UniProtKB/Swiss-Prot), A6JDT8 (UniProtKB/TrEMBL), A0A8L2QSN3 (UniProtKB/TrEMBL)
- Sequence:
MIIQRVVLDSRPGKNGNPVAENFRVEEVSLPDTINEGQVRVRTLYLSVDPYMRCKMNEETGADY
hide sequence
RefSeq Acc Id:
XP_006240391 ⟸ XM_006240329
- Peptide Label:
isoform X2
- UniProtKB:
A6JDU5 (UniProtKB/TrEMBL)
- Sequence:
MNEETGADYLAPWQLAQVADGGGLGVIEESKHQKLAKGDFVTSFYWPWQTKAILDGNGLEKVDP
hide sequence
Ensembl Acc Id:
ENSRNOP00000054903 ⟸ ENSRNOT00000058095
Ensembl Acc Id:
ENSRNOP00000055851 ⟸ ENSRNOT00000059073
RefSeq Acc Id:
XP_038967954 ⟸ XM_039112026
- Peptide Label:
isoform X4
- UniProtKB:
A6JDU4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000080851 ⟸ ENSRNOT00000118264
RefSeq Acc Id:
NP_001386362 ⟸ NM_001399433
- Peptide Label:
isoform 3
- UniProtKB:
A0A8I6G545 (UniProtKB/TrEMBL), A0A8L2QSN3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386355 ⟸ NM_001399426
- Peptide Label:
isoform 1
- UniProtKB:
Q5BK81 (UniProtKB/Swiss-Prot), A6JDT8 (UniProtKB/TrEMBL), A0A8L2QSN3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063117805 ⟸ XM_063261735
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063117803 ⟸ XM_063261733
- Peptide Label:
isoform X1
- UniProtKB:
Q5BK81 (UniProtKB/Swiss-Prot), A6JDT8 (UniProtKB/TrEMBL), A0A8L2QSN3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063117804 ⟸ XM_063261734
- Peptide Label:
isoform X1
- UniProtKB:
Q5BK81 (UniProtKB/Swiss-Prot), A6JDT8 (UniProtKB/TrEMBL), A0A8L2QSN3 (UniProtKB/TrEMBL)
RGD ID: 13694722 Promoter ID: EPDNEW_R5246 Type: initiation region Name: Ptgr2_1 Description: prostaglandin reductase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 107,999,837 - 107,999,897 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-23
Ptgr2
prostaglandin reductase 2
Zadh1
zinc binding alcohol dehydrogenase, domain containing 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Zadh1
zinc binding alcohol dehydrogenase, domain containing 1
Zadh1_predicted
zinc binding alcohol dehydrogenase, domain containing 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Zadh1_predicted
zinc binding alcohol dehydrogenase, domain containing 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
