Symbol:
Osgep
Name:
O-sialoglycoprotein endopeptidase
RGD ID:
1308578
Description:
Predicted to enable N(6)-L-threonylcarbamoyladenine synthase activity. Predicted to be involved in tRNA threonylcarbamoyladenosine modification. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of EKC/KEOPS complex. Predicted to be active in cytoplasm. Human ortholog(s) of this gene implicated in Galloway-Mowat syndrome 3. Orthologous to human OSGEP (O-sialoglycoprotein endopeptidase); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC290028; N6-L-threonylcarbamoyladenine synthase; O-sialoglycoprotease; pasteurella haemolytica metalloprotease homolog with glycoprotein substrates/gpc-like protein 1; probable O-sialoglycoprotein endopeptidase; probable tRNA N6-adenosine threonylcarbamoyltransferase; probable tRNA threonylcarbamoyladenosine biosynthesis protein Osgep; Prsmg1/Gcpl1; t(6)A synthase; t(6)A37 threonylcarbamoyladenosine biosynthesis protein Osgep; tRNA N6-adenosine threonylcarbamoyltransferase; tRNA threonylcarbamoyladenosine biosynthesis protein Osgep
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
OSGEP (O-sialoglycoprotein endopeptidase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Osgep (O-sialoglycoprotein endopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Osgep (O-sialoglycoprotein endopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
OSGEP (O-sialoglycoprotein endopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
OSGEP (O-sialoglycoprotein endopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Osgep (O-sialoglycoprotein endopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
OSGEP (O-sialoglycoprotein endopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
OSGEP (O-sialoglycoprotein endopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Osgep (O-sialoglycoprotein endopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NPHS2 (NPHS2 stomatin family member, podocin) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
OSGEP (O-sialoglycoprotein endopeptidase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Osgep (O-sialoglycoprotein endopeptidase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
osgep (O-sialoglycoprotein endopeptidase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
KAE1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Tcs3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
Y71H2AM.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
osgep
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fitm1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 26,610,694 - 26,618,113 (-) NCBI GRCr8 mRatBN7.2 15 24,137,149 - 24,144,568 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 24,137,153 - 24,144,568 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 26,908,335 - 26,915,754 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 27,867,039 - 27,874,458 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 26,116,878 - 26,124,297 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 27,842,447 - 27,849,866 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 27,842,422 - 27,849,974 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 31,674,872 - 31,682,291 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 26,896,592 - 26,904,011 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 26,912,465 - 26,919,623 (-) NCBI Celera 15 24,457,277 - 24,464,696 (-) NCBI Celera Cytogenetic Map 15 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Osgep Rat (-)-epigallocatechin 3-gallate multiple interactions ISO OSGEP (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of OSGEP mRNA CTD PMID:22079256 Osgep Rat (1->4)-beta-D-glucan multiple interactions ISO Osgep (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of OSGEP mRNA CTD PMID:36331819 Osgep Rat 1,2-dimethylhydrazine multiple interactions ISO Osgep (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of OSGEP mRNA CTD PMID:22206623 Osgep Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO OSGEP (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Osgep Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Osgep (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of OSGEP mRNA CTD PMID:21570461 Osgep Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of OSGEP mRNA CTD PMID:33387578 Osgep Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO OSGEP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of OSGEP mRNA CTD PMID:28628672 Osgep Rat 4,4'-diaminodiphenylmethane increases expression ISO Osgep (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of OSGEP mRNA CTD PMID:18648102 Osgep Rat 4-hydroxyphenyl retinamide decreases expression ISO Osgep (Mus musculus) 6480464 Fenretinide results in decreased expression of OSGEP mRNA CTD PMID:28973697 Osgep Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of OSGEP mRNA CTD PMID:16483693 Osgep Rat aristolochic acid A increases expression ISO OSGEP (Homo sapiens) 6480464 aristolochic acid I results in increased expression of OSGEP protein CTD PMID:33212167 Osgep Rat arsane affects methylation ISO OSGEP (Homo sapiens) 6480464 Arsenic affects the methylation of OSGEP gene CTD PMID:25304211 Osgep Rat arsenic atom affects methylation ISO OSGEP (Homo sapiens) 6480464 Arsenic affects the methylation of OSGEP gene CTD PMID:25304211 Osgep Rat arsenite(3-) multiple interactions ISO OSGEP (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to OSGEP mRNA] CTD PMID:32406909 Osgep Rat atrazine decreases expression ISO OSGEP (Homo sapiens) 6480464 Atrazine results in decreased expression of OSGEP mRNA CTD PMID:22378314 Osgep Rat bisphenol A decreases expression ISO OSGEP (Homo sapiens) 6480464 bisphenol A results in decreased expression of OSGEP mRNA and bisphenol A results in decreased expression of OSGEP protein CTD PMID:25047013 more ... Osgep Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of OSGEP mRNA CTD PMID:34947998 Osgep Rat bisphenol A multiple interactions ISO OSGEP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of OSGEP mRNA CTD PMID:28628672 Osgep Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of OSGEP mRNA CTD PMID:25181051 Osgep Rat butan-1-ol multiple interactions ISO OSGEP (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of OSGEP mRNA CTD PMID:29432896 Osgep Rat cadmium atom multiple interactions ISO OSGEP (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of OSGEP mRNA CTD PMID:35301059 Osgep Rat cadmium dichloride multiple interactions ISO OSGEP (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of OSGEP mRNA CTD PMID:35301059 Osgep Rat carbon nanotube decreases expression ISO Osgep (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Osgep Rat clofibrate decreases expression ISO Osgep (Mus musculus) 6480464 Clofibrate results in decreased expression of OSGEP mRNA CTD PMID:23811191 Osgep Rat copper(II) sulfate decreases expression ISO OSGEP (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of OSGEP mRNA CTD PMID:19549813 Osgep Rat crocidolite asbestos decreases expression ISO OSGEP (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of OSGEP mRNA CTD PMID:29523930 Osgep Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of OSGEP mRNA CTD PMID:26577399 Osgep Rat DDE increases expression ISO OSGEP (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of OSGEP mRNA CTD PMID:38568856 Osgep Rat decabromodiphenyl ether decreases expression ISO OSGEP (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of OSGEP protein CTD PMID:31675489 Osgep Rat dexamethasone multiple interactions ISO OSGEP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of OSGEP mRNA CTD PMID:28628672 Osgep Rat elemental selenium increases expression ISO OSGEP (Homo sapiens) 6480464 Selenium results in increased expression of OSGEP mRNA CTD PMID:19244175 Osgep Rat folic acid decreases expression ISO Osgep (Mus musculus) 6480464 Folic Acid results in decreased expression of OSGEP mRNA CTD PMID:25629700 Osgep Rat folic acid multiple interactions ISO Osgep (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of OSGEP mRNA CTD PMID:22206623 Osgep Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of OSGEP mRNA CTD PMID:33387578 Osgep Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of OSGEP mRNA CTD PMID:24136188 Osgep Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of OSGEP mRNA CTD PMID:21396975 Osgep Rat indometacin multiple interactions ISO OSGEP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of OSGEP mRNA CTD PMID:28628672 Osgep Rat ivermectin decreases expression ISO OSGEP (Homo sapiens) 6480464 Ivermectin results in decreased expression of OSGEP protein CTD PMID:32959892 Osgep Rat paracetamol affects expression ISO Osgep (Mus musculus) 6480464 Acetaminophen affects the expression of OSGEP mRNA CTD PMID:17562736 Osgep Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Osgep (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of OSGEP mRNA CTD PMID:36331819 Osgep Rat potassium chromate decreases expression ISO OSGEP (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of OSGEP mRNA CTD PMID:22079256 Osgep Rat potassium chromate multiple interactions ISO OSGEP (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of OSGEP mRNA CTD PMID:22079256 Osgep Rat resveratrol multiple interactions ISO OSGEP (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of OSGEP mRNA CTD PMID:23557933 Osgep Rat selenium atom increases expression ISO OSGEP (Homo sapiens) 6480464 Selenium results in increased expression of OSGEP mRNA CTD PMID:19244175 Osgep Rat sodium arsenite decreases expression ISO OSGEP (Homo sapiens) 6480464 sodium arsenite results in decreased expression of OSGEP mRNA CTD PMID:38568856 Osgep Rat temozolomide increases expression ISO OSGEP (Homo sapiens) 6480464 Temozolomide results in increased expression of OSGEP mRNA CTD PMID:31758290 Osgep Rat trichloroethene affects expression ISO Osgep (Mus musculus) 6480464 Trichloroethylene affects the expression of OSGEP mRNA CTD PMID:21135412 Osgep Rat triphenyl phosphate affects expression ISO OSGEP (Homo sapiens) 6480464 triphenyl phosphate affects the expression of OSGEP mRNA CTD PMID:37042841 Osgep Rat triptonide decreases expression ISO Osgep (Mus musculus) 6480464 triptonide results in decreased expression of OSGEP mRNA CTD PMID:33045310 Osgep Rat trovafloxacin decreases expression ISO Osgep (Mus musculus) 6480464 trovafloxacin results in decreased expression of OSGEP mRNA CTD PMID:35537566 Osgep Rat tungsten increases expression ISO Osgep (Mus musculus) 6480464 Tungsten results in increased expression of OSGEP mRNA CTD PMID:30912803 Osgep Rat valproic acid increases expression ISO OSGEP (Homo sapiens) 6480464 Valproic Acid results in increased expression of OSGEP mRNA CTD PMID:23179753
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxyphenyl retinamide (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (ISO) bisphenol A (EXP,ISO) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) clofibrate (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) DDE (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) elemental selenium (ISO) folic acid (ISO) gentamycin (EXP) glafenine (EXP) indole-3-methanol (EXP) indometacin (ISO) ivermectin (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) potassium chromate (ISO) resveratrol (ISO) selenium atom (ISO) sodium arsenite (ISO) temozolomide (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) triptonide (ISO) trovafloxacin (ISO) tungsten (ISO) valproic acid (ISO)
Cellular Component
cytoplasm (IBA,IEA,ISO,ISS) cytosol (IEA,ISO) EKC/KEOPS complex (IBA,IEA,ISO,ISS) nucleoplasm (IEA,ISO) nucleus (IEA,ISO,ISS)
Osgep Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 26,610,694 - 26,618,113 (-) NCBI GRCr8 mRatBN7.2 15 24,137,149 - 24,144,568 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 24,137,153 - 24,144,568 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 26,908,335 - 26,915,754 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 27,867,039 - 27,874,458 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 26,116,878 - 26,124,297 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 27,842,447 - 27,849,866 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 27,842,422 - 27,849,974 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 31,674,872 - 31,682,291 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 26,896,592 - 26,904,011 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 26,912,465 - 26,919,623 (-) NCBI Celera 15 24,457,277 - 24,464,696 (-) NCBI Celera Cytogenetic Map 15 p14 NCBI
OSGEP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 20,446,401 - 20,454,812 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 20,446,401 - 20,455,089 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 20,914,560 - 20,922,971 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 19,985,056 - 19,993,038 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 19,985,055 - 19,993,038 NCBI Celera 14 776,357 - 784,417 (-) NCBI Celera Cytogenetic Map 14 q11.2 NCBI HuRef 14 1,036,962 - 1,044,886 (-) NCBI HuRef CHM1_1 14 20,916,587 - 20,924,647 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 14,643,301 - 14,651,715 (-) NCBI T2T-CHM13v2.0
Osgep Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 51,152,831 - 51,162,350 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 51,143,935 - 51,162,350 (-) Ensembl GRCm39 Ensembl GRCm38 14 50,915,374 - 50,924,893 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 50,906,478 - 50,924,893 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 51,535,049 - 51,544,568 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 49,837,325 - 49,846,844 (-) NCBI MGSCv36 mm8 Celera 14 47,206,136 - 47,224,482 (-) NCBI Celera Cytogenetic Map 14 C1 NCBI cM Map 14 26.3 NCBI
Osgep Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955550 1,265,401 - 1,273,299 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955550 1,266,191 - 1,273,093 (-) NCBI ChiLan1.0 ChiLan1.0
OSGEP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 21,956,556 - 21,964,635 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 21,173,043 - 21,181,122 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 1,321,599 - 1,329,604 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 19,373,836 - 19,381,888 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 19,373,836 - 19,381,888 (-) Ensembl panpan1.1 panPan2
OSGEP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 17,780,474 - 17,786,452 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 17,780,476 - 17,811,173 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 18,263,462 - 18,269,439 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 18,037,539 - 18,043,534 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 18,037,541 - 18,043,514 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 17,720,433 - 17,726,396 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 17,775,053 - 17,781,030 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 17,904,232 - 17,910,209 (-) NCBI UU_Cfam_GSD_1.0
Osgep
OSGEP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 78,454,666 - 78,462,258 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 78,454,667 - 78,462,260 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 83,482,276 - 83,490,100 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OSGEP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 20,960,710 - 20,969,321 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 20,960,378 - 20,968,903 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 25,451,480 - 25,460,413 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Osgep
.
Predicted Target Of
Count of predictions: 107 Count of miRNA genes: 92 Interacting mature miRNAs: 98 Transcripts: ENSRNOT00000012790 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 10755503 Bp391 Blood pressure QTL 391 2.37 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 20248600 37896129 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 5685002 Bss103 Bone structure and strength QTL 103 2.8 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 15 14481165 28469888 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 2324620 Coatc3 Coat color QTL 3 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 15 19856566 46187442 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 631550 Bw7 Body weight QTL 7 3.6 body mass (VT:0001259) body weight (CMO:0000012) 15 19856566 34924750 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012790 ⟹ ENSRNOP00000012789
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 24,137,153 - 24,144,568 (-) Ensembl Rnor_6.0 Ensembl 15 27,842,422 - 27,849,974 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097357 ⟹ ENSRNOP00000092779
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 24,137,153 - 24,144,537 (-) Ensembl
RefSeq Acc Id:
NM_001100510 ⟹ NP_001093980
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 26,610,694 - 26,618,113 (-) NCBI mRatBN7.2 15 24,137,149 - 24,144,568 (-) NCBI Rnor_6.0 15 27,842,447 - 27,849,866 (-) NCBI Rnor_5.0 15 31,674,872 - 31,682,291 (-) NCBI RGSC_v3.4 15 26,896,592 - 26,904,011 (-) RGD Celera 15 24,457,277 - 24,464,696 (-) RGD
Sequence:
GAAGGTCCCTTCGCTTGGTTCTGGGTCGTTCATCGCGGTGCCGGTTACAGCTAGTCCTTCAGTTCCACGATCCCGAATCACGGGGTATCATGCCCGCGGTGCTGGGGTTCGAAGGCAGCGCCAACAAG
hide sequence
RefSeq Acc Id:
XM_039093106 ⟹ XP_038949034
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 26,610,694 - 26,618,037 (-) NCBI mRatBN7.2 15 24,137,149 - 24,144,553 (-) NCBI
RefSeq Acc Id:
XM_063274101 ⟹ XP_063130171
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 26,610,694 - 26,618,044 (-) NCBI
RefSeq Acc Id:
XR_005493700
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 26,612,241 - 26,618,041 (-) NCBI mRatBN7.2 15 24,137,149 - 24,144,559 (-) NCBI
RefSeq Acc Id:
NP_001093980 ⟸ NM_001100510
- UniProtKB:
B0BMW7 (UniProtKB/Swiss-Prot), Q9WVS2 (UniProtKB/Swiss-Prot), A0A8I6AEB6 (UniProtKB/TrEMBL)
- Sequence:
MPAVLGFEGSANKIGVGVVRDGTVLANPRRTYVTAPGTGFLPGDTARHHRAVILDLLQEALTEAGLTPKDIDCIAYTKGPGMGAPLASVAVVARTVAQLWNKPLLGVNHCIGHIEMGRLITGAVNPTV
hide sequence
Ensembl Acc Id:
ENSRNOP00000012789 ⟸ ENSRNOT00000012790
RefSeq Acc Id:
XP_038949034 ⟸ XM_039093106
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000092779 ⟸ ENSRNOT00000097357
RefSeq Acc Id:
XP_063130171 ⟸ XM_063274101
- Peptide Label:
isoform X1
RGD ID: 13699624 Promoter ID: EPDNEW_R10146 Type: initiation region Name: Osgep_1 Description: O-sialoglycoprotein endopeptidase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 27,849,891 - 27,849,951 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Osgep
O-sialoglycoprotein endopeptidase
Osgep_predicted
O-sialoglycoprotein endopeptidase (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Osgep_predicted
O-sialoglycoprotein endopeptidase (predicted)
Symbol and Name status set to approved
70820 APPROVED
