Symbol:
Ptpa
Name:
protein phosphatase 2 phosphatase activator
RGD ID:
1308354
Description:
Predicted to enable several functions, including ATP binding activity; protein homodimerization activity; and protein phosphatase 2A binding activity. Predicted to contribute to phosphoprotein phosphatase activity. Predicted to be involved in mitotic spindle organization and positive regulation of apoptotic process. Predicted to be located in nucleoplasm. Predicted to be part of ATPase complex; calcium channel complex; and protein phosphatase type 2A complex. Predicted to be active in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in Parkinson's disease 25. Orthologous to human PTPA (protein phosphatase 2 phosphatase activator); PARTICIPATES IN p53 signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC362102; Ppp2r4; protein phosphatase 2 regulatory subunit 4; protein phosphatase 2A activator, regulatory subunit 4; protein phosphatase 2A regulatory subunit 4; protein phosphatase 2A, regulatory subunit B (PR 53); protein phosphatase 2a, regulatory subunit b' (pr 53); serine/threonine-protein phosphatase 2A activator
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 34,087,637 - 34,118,100 (+) NCBI GRCr8 mRatBN7.2 3 13,689,742 - 13,720,287 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 13,689,741 - 13,722,549 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 16,761,350 - 16,791,813 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 25,346,312 - 25,376,773 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 23,592,281 - 23,622,965 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 8,982,122 - 9,012,585 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 8,982,122 - 9,012,585 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 14,334,896 - 14,365,358 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 9,461,718 - 9,492,181 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 9,472,909 - 9,491,620 (+) NCBI Celera 3 8,456,362 - 8,486,834 (+) NCBI Celera Cytogenetic Map 3 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ptpa Rat 1,2-dimethylhydrazine increases expression ISO Ptpa (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PTPA mRNA CTD PMID:22206623 Ptpa Rat 1,2-dimethylhydrazine multiple interactions ISO Ptpa (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PTPA mRNA CTD PMID:22206623 Ptpa Rat 17alpha-ethynylestradiol affects expression ISO Ptpa (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PTPA mRNA CTD PMID:17555576 Ptpa Rat 17beta-estradiol multiple interactions ISO PTPA (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of PTPA mRNA CTD PMID:20823114 Ptpa Rat 17beta-estradiol increases expression ISO Ptpa (Mus musculus) 6480464 Estradiol results in increased expression of PTPA mRNA CTD PMID:39298647 Ptpa Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PTPA mRNA CTD PMID:32145629 Ptpa Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ptpa (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PTPA mRNA CTD PMID:21570461 and PMID:24680724 Ptpa Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PTPA mRNA CTD PMID:34747641 Ptpa Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PTPA mRNA CTD PMID:21346803 Ptpa Rat 3,4-methylenedioxymethamphetamine increases expression ISO Ptpa (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PTPA mRNA CTD PMID:20188158 Ptpa Rat 4,4'-diaminodiphenylmethane increases expression ISO Ptpa (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PTPA mRNA CTD PMID:18648102 Ptpa Rat 4,4'-sulfonyldiphenol increases expression ISO Ptpa (Mus musculus) 6480464 bisphenol S results in increased expression of PTPA mRNA CTD PMID:39298647 Ptpa Rat 4,4'-sulfonyldiphenol increases expression ISO PTPA (Homo sapiens) 6480464 bisphenol S results in increased expression of PTPA protein CTD PMID:34186270 Ptpa Rat 5-azacytidine increases expression ISO PTPA (Homo sapiens) 6480464 Azacitidine results in increased expression of PTPA mRNA CTD PMID:20823114 Ptpa Rat acrolein multiple interactions ISO PTPA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PTPA mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PTPA mRNA CTD PMID:32699268 Ptpa Rat aflatoxin B1 increases methylation ISO PTPA (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PTPA intron CTD PMID:30157460 Ptpa Rat alpha-pinene multiple interactions ISO PTPA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PTPA mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PTPA mRNA CTD PMID:32699268 Ptpa Rat aristolochic acid A increases expression ISO PTPA (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PTPA protein CTD PMID:33212167 Ptpa Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PTPA mRNA CTD PMID:33854195 Ptpa Rat beta-lapachone increases expression ISO PTPA (Homo sapiens) 6480464 beta-lapachone results in increased expression of PTPA mRNA CTD PMID:38218311 Ptpa Rat bis(2-ethylhexyl) phthalate increases expression ISO Ptpa (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PTPA mRNA CTD PMID:34319233 Ptpa Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PTPA mRNA CTD PMID:25181051 Ptpa Rat bisphenol A multiple interactions ISO PTPA (Homo sapiens) 6480464 [ginger extract results in increased abundance of Oils and Volatile] inhibits the reaction [bisphenol A results in increased expression of PTPA protein] CTD PMID:33376534 Ptpa Rat bisphenol A increases expression ISO PTPA (Homo sapiens) 6480464 bisphenol A results in increased expression of PTPA protein CTD PMID:33376534 Ptpa Rat bisphenol A increases expression ISO Ptpa (Mus musculus) 6480464 bisphenol A results in increased expression of PTPA mRNA CTD PMID:32156529 and PMID:33221593 Ptpa Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PTPA mRNA CTD PMID:32145629 Ptpa Rat Bisphenol B increases expression ISO PTPA (Homo sapiens) 6480464 bisphenol B results in increased expression of PTPA protein CTD PMID:34186270 Ptpa Rat bisphenol F increases expression ISO PTPA (Homo sapiens) 6480464 bisphenol F results in increased expression of PTPA protein CTD PMID:34186270 Ptpa Rat bucladesine multiple interactions ISO PTPA (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of PTPA mRNA CTD PMID:20823114 Ptpa Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PTPA mRNA CTD PMID:33453195 Ptpa Rat cadmium dichloride increases expression ISO PTPA (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PTPA mRNA CTD PMID:26472689 Ptpa Rat calcitriol decreases expression ISO PTPA (Homo sapiens) 6480464 Calcitriol results in decreased expression of PTPA mRNA CTD PMID:16002434 Ptpa Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PTPA mRNA CTD PMID:33854195 Ptpa Rat chlorpyrifos increases expression ISO Ptpa (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PTPA mRNA CTD PMID:37019170 Ptpa Rat clobetasol increases expression ISO Ptpa (Mus musculus) 6480464 Clobetasol results in increased expression of PTPA mRNA CTD PMID:27462272 Ptpa Rat cobalt dichloride decreases expression ISO PTPA (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PTPA mRNA CTD PMID:19376846 Ptpa Rat Dibutyl phosphate affects expression ISO PTPA (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PTPA mRNA CTD PMID:37042841 Ptpa Rat dioxygen multiple interactions ISO Ptpa (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of PTPA mRNA CTD PMID:30529165 Ptpa Rat disodium selenite decreases expression ISO PTPA (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of PTPA mRNA CTD PMID:18175754 Ptpa Rat doxorubicin increases expression ISO PTPA (Homo sapiens) 6480464 Doxorubicin results in increased expression of PTPA mRNA CTD PMID:29803840 Ptpa Rat elemental selenium multiple interactions ISO PTPA (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of PTPA mRNA CTD PMID:19244175 Ptpa Rat elemental selenium increases expression ISO PTPA (Homo sapiens) 6480464 Selenium results in increased expression of PTPA mRNA CTD PMID:19244175 Ptpa Rat ethanol affects splicing ISO Ptpa (Mus musculus) 6480464 Ethanol affects the splicing of PTPA mRNA CTD PMID:30319688 Ptpa Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PTPA mRNA CTD PMID:24136188 Ptpa Rat folic acid decreases expression ISO Ptpa (Mus musculus) 6480464 Folic Acid results in decreased expression of PTPA mRNA CTD PMID:25629700 Ptpa Rat folic acid multiple interactions ISO Ptpa (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PTPA mRNA CTD PMID:22206623 Ptpa Rat furan increases methylation EXP 6480464 furan results in increased methylation of PTPA gene CTD PMID:22079235 Ptpa Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PTPA mRNA CTD PMID:33854195 Ptpa Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PTPA mRNA CTD PMID:33854195 Ptpa Rat ivermectin decreases expression ISO PTPA (Homo sapiens) 6480464 Ivermectin results in decreased expression of PTPA protein CTD PMID:32959892 Ptpa Rat medroxyprogesterone acetate multiple interactions ISO PTPA (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of PTPA mRNA CTD PMID:20823114 Ptpa Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PTPA mRNA CTD PMID:25729387 Ptpa Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of PTPA mRNA CTD PMID:25729387 Ptpa Rat ozone multiple interactions ISO PTPA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PTPA mRNA more ... CTD PMID:32699268 Ptpa Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of PTPA protein CTD PMID:33146391 Ptpa Rat paracetamol decreases expression ISO PTPA (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PTPA mRNA CTD PMID:21420995 more ... Ptpa Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PTPA mRNA CTD PMID:33387578 Ptpa Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Ptpa Rat phenobarbital decreases expression ISO Ptpa (Mus musculus) 6480464 Phenobarbital results in decreased expression of PTPA mRNA CTD PMID:19270015 Ptpa Rat pirinixic acid increases expression ISO Ptpa (Mus musculus) 6480464 pirinixic acid results in increased expression of PTPA mRNA CTD PMID:17426115 more ... Ptpa Rat quercetin decreases expression ISO PTPA (Homo sapiens) 6480464 Quercetin results in decreased expression of PTPA mRNA CTD PMID:15309432 Ptpa Rat selenium atom multiple interactions ISO PTPA (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of PTPA mRNA CTD PMID:19244175 Ptpa Rat selenium atom increases expression ISO PTPA (Homo sapiens) 6480464 Selenium results in increased expression of PTPA mRNA CTD PMID:19244175 Ptpa Rat sodium arsenite decreases expression ISO Ptpa (Mus musculus) 6480464 sodium arsenite results in decreased expression of PTPA mRNA CTD PMID:36209798 Ptpa Rat sulforaphane multiple interactions ISO Ptpa (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of PTPA mRNA CTD PMID:30529165 Ptpa Rat sunitinib decreases expression ISO PTPA (Homo sapiens) 6480464 Sunitinib results in decreased expression of PTPA mRNA CTD PMID:31533062 Ptpa Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PTPA mRNA CTD PMID:33854195 Ptpa Rat thiram decreases expression ISO PTPA (Homo sapiens) 6480464 Thiram results in decreased expression of PTPA mRNA CTD PMID:38568856 Ptpa Rat titanium dioxide decreases methylation ISO Ptpa (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PTPA gene CTD PMID:35295148 Ptpa Rat toluene affects expression EXP 6480464 Toluene affects the expression of PTPA mRNA CTD PMID:21827849 Ptpa Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PTPA mRNA CTD PMID:25729387 Ptpa Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of PTPA mRNA CTD PMID:25729387 Ptpa Rat triptonide affects expression ISO Ptpa (Mus musculus) 6480464 triptonide affects the expression of PTPA mRNA CTD PMID:33045310 Ptpa Rat valproic acid increases methylation ISO PTPA (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PTPA gene CTD PMID:29154799 Ptpa Rat valproic acid decreases expression ISO PTPA (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PTPA mRNA CTD PMID:29154799 Ptpa Rat vitamin E multiple interactions ISO PTPA (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of PTPA mRNA CTD PMID:19244175 Ptpa Rat vitamin E increases expression ISO PTPA (Homo sapiens) 6480464 Vitamin E results in increased expression of PTPA mRNA CTD PMID:19244175
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-azacytidine (ISO) acrolein (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) azoxystrobin (EXP) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) bucladesine (ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) chlorpyrifos (EXP,ISO) clobetasol (ISO) cobalt dichloride (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) disodium selenite (ISO) doxorubicin (ISO) elemental selenium (ISO) ethanol (ISO) finasteride (EXP) folic acid (ISO) furan (EXP) glyphosate (EXP) imidacloprid (EXP) ivermectin (ISO) medroxyprogesterone acetate (ISO) oxaliplatin (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) PCB138 (EXP) phenobarbital (ISO) pirinixic acid (ISO) quercetin (ISO) selenium atom (ISO) sodium arsenite (ISO) sulforaphane (ISO) sunitinib (ISO) thiabendazole (EXP) thiram (ISO) titanium dioxide (ISO) toluene (EXP) topotecan (EXP) triptonide (ISO) valproic acid (ISO) vitamin E (ISO)
Ptpa Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 34,087,637 - 34,118,100 (+) NCBI GRCr8 mRatBN7.2 3 13,689,742 - 13,720,287 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 13,689,741 - 13,722,549 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 16,761,350 - 16,791,813 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 25,346,312 - 25,376,773 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 23,592,281 - 23,622,965 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 8,982,122 - 9,012,585 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 8,982,122 - 9,012,585 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 14,334,896 - 14,365,358 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 9,461,718 - 9,492,181 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 9,472,909 - 9,491,620 (+) NCBI Celera 3 8,456,362 - 8,486,834 (+) NCBI Celera Cytogenetic Map 3 p12 NCBI
PTPA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 129,110,950 - 129,148,946 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 129,110,950 - 129,148,946 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 131,873,229 - 131,911,225 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 130,913,065 - 130,951,044 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 128,953,166 - 128,990,777 NCBI Celera 9 102,525,511 - 102,563,513 (+) NCBI Celera Cytogenetic Map 9 q34.11 NCBI HuRef 9 101,480,193 - 101,518,132 (+) NCBI HuRef CHM1_1 9 132,024,045 - 132,062,045 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 141,314,397 - 141,352,390 (+) NCBI T2T-CHM13v2.0
Ptpa Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 30,306,062 - 30,337,819 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 30,306,051 - 30,337,818 (+) Ensembl GRCm39 Ensembl GRCm38 2 30,416,050 - 30,447,807 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 30,416,039 - 30,447,806 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 30,271,570 - 30,303,327 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 30,238,059 - 30,269,813 (+) NCBI MGSCv36 mm8 Celera 2 30,120,848 - 30,152,502 (+) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 21.71 NCBI
Ptpa Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955570 1,429,316 - 1,455,562 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955570 1,429,316 - 1,454,820 (+) NCBI ChiLan1.0 ChiLan1.0
PTPA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 10,202,540 - 10,240,224 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 10,204,886 - 10,242,570 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 100,236,607 - 100,274,273 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 128,896,584 - 128,934,651 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 128,896,584 - 128,934,651 (+) Ensembl panpan1.1 panPan2
PTPA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 54,535,186 - 54,568,632 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 54,536,180 - 54,566,235 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 53,730,775 - 53,764,220 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 55,430,817 - 55,464,245 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 55,426,235 - 55,461,851 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 54,217,697 - 54,250,902 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 54,529,536 - 54,562,790 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 54,623,019 - 54,656,500 (-) NCBI UU_Cfam_GSD_1.0
Ptpa Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 196,768,400 - 196,795,560 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936487 16,542,888 - 16,564,646 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936487 16,536,740 - 16,564,087 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PTPA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 269,401,514 - 269,431,462 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 269,401,776 - 269,431,465 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 303,417,989 - 303,447,667 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PTPA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 9,017,533 - 9,056,856 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 9,019,024 - 9,056,703 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666096 506,991 - 549,730 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ptpa
.
Predicted Target Of
Count of predictions: 167 Count of miRNA genes: 111 Interacting mature miRNAs: 134 Transcripts: ENSRNOT00000024914 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1558647 Cm46 Cardiac mass QTL 46 5.4 0.0000055 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 1358357 Srcrtb1 Stress Responsive Cort Basal QTL 1 6.36 0.002 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 8658162 27494778 Rat 6893355 Bw101 Body weight QTL 101 0.4 0.38 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 4889966 Bss95 Bone structure and strength QTL 95 4.4 tibia area (VT:1000281) tibia-fibula cross-sectional area (CMO:0001718) 3 1 36847613 Rat 1558654 Bw56 Body weight QTL 56 4.5 0.0000171 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 1298526 Arunc3 Aerobic running capacity QTL 3 2.2 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 8227194 33703538 Rat 8693641 Alc30 Alcohol consumption QTL 30 2 0.739 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 3 10434306 24512004 Rat 1558650 Cm48 Cardiac mass QTL 48 4 0.0001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 3 10778823 30356773 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 631545 Bp85 Blood pressure QTL 85 3.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 33278763 Rat 631679 Cm10 Cardiac mass QTL 10 7.34 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 1 31158234 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 1558657 Cm43 Cardiac mass QTL 43 6.6 3e-08 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 631568 Bp92 Blood pressure QTL 92 2.2 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 39874793 Rat 70203 Gcr2 Gastric cancer resistance QTL 2 2.6 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 3 8658162 27494778 Rat 6893363 Bw105 Body weight QTL 105 2.6 0.0036 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 70202 Alc19 Alcohol consumption QTL 19 2.5 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 3 1 27494778 Rat 2312664 Scl62 Serum cholesterol level QTL 62 0.05 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 1 38710544 Rat 61468 Bp15 Blood pressure QTL 15 4.4 blood pressure trait (VT:0000183) pulse pressure (CMO:0000292) 3 1 33278763 Rat 631831 Alc8 Alcohol consumption QTL 8 2.7 consumption behavior trait (VT:0002069) calculated ethanol drink intake rate (CMO:0001615) 3 1 33230976 Rat
D3Mco30
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 13,708,362 - 13,708,392 (+) MAPPER mRatBN7.2 mRatBN7.2 3 13,708,362 - 13,708,597 (+) MAPPER mRatBN7.2 Rnor_6.0 3 9,000,661 - 9,000,895 NCBI Rnor6.0 Rnor_6.0 3 9,000,661 - 9,000,690 NCBI Rnor6.0 Rnor_5.0 3 14,353,434 - 14,353,463 UniSTS Rnor5.0 Rnor_5.0 3 14,353,434 - 14,353,668 UniSTS Rnor5.0 RGSC_v3.4 3 9,480,257 - 9,480,491 UniSTS RGSC3.4 RGSC_v3.4 3 9,480,256 - 9,480,491 RGD RGSC3.4 RGSC_v3.4 3 9,480,257 - 9,480,286 UniSTS RGSC3.4 RGSC_v3.1 3 9,480,587 - 9,480,822 RGD Celera 3 8,474,910 - 8,475,144 UniSTS Celera 3 8,474,910 - 8,474,939 UniSTS Cytogenetic Map 3 p12 UniSTS
RH127941
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 13,720,088 - 13,720,271 (+) MAPPER mRatBN7.2 Rnor_6.0 3 9,012,387 - 9,012,569 NCBI Rnor6.0 Rnor_5.0 3 14,365,160 - 14,365,342 UniSTS Rnor5.0 RGSC_v3.4 3 9,491,983 - 9,492,165 UniSTS RGSC3.4 Celera 3 8,486,636 - 8,486,818 UniSTS RH 3.4 Map 3 51.81 UniSTS Cytogenetic Map 3 p12 UniSTS
RH125061
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 13,720,078 - 13,720,273 (+) MAPPER mRatBN7.2 Rnor_6.0 3 9,012,377 - 9,012,571 NCBI Rnor6.0 Rnor_5.0 3 14,365,150 - 14,365,344 UniSTS Rnor5.0 RGSC_v3.4 3 9,491,973 - 9,492,167 UniSTS RGSC3.4 Celera 3 8,486,626 - 8,486,820 UniSTS Cytogenetic Map 3 p12 UniSTS
REN36142
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 13,713,720 - 13,713,971 (+) MAPPER mRatBN7.2 Rnor_6.0 3 9,006,019 - 9,006,269 NCBI Rnor6.0 Rnor_5.0 3 14,358,792 - 14,359,042 UniSTS Rnor5.0 RGSC_v3.4 3 9,485,615 - 9,485,865 UniSTS RGSC3.4 Celera 3 8,480,268 - 8,480,518 UniSTS Cytogenetic Map 3 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024914 ⟹ ENSRNOP00000024914
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 13,689,742 - 13,720,271 (+) Ensembl Rnor_6.0 Ensembl 3 8,982,122 - 9,012,585 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107089 ⟹ ENSRNOP00000097647
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 13,689,741 - 13,722,549 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108066 ⟹ ENSRNOP00000080286
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 13,689,741 - 13,717,299 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108795 ⟹ ENSRNOP00000080651
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 13,689,742 - 13,720,271 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118909 ⟹ ENSRNOP00000097534
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 13,689,742 - 13,720,271 (+) Ensembl
RefSeq Acc Id:
NM_001108577 ⟹ NP_001102047
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 34,087,637 - 34,118,100 (+) NCBI mRatBN7.2 3 13,689,821 - 13,720,287 (+) NCBI Rnor_6.0 3 8,982,122 - 9,012,585 (+) NCBI Rnor_5.0 3 14,334,896 - 14,365,358 (+) NCBI RGSC_v3.4 3 9,461,718 - 9,492,181 (+) RGD Celera 3 8,456,362 - 8,486,834 (+) RGD
Sequence:
CTCCCTGAGTGCCTCGCTCCGGCATGGCTGCCGCTTTCACAGGAGTGTCTGTAATTCTCGGCTTCCGGTCGTAGCGGGCCAGCGCTCATTTCCCTGCTGGAAGCTGGGTAGAGCCGGGGAGAGGTGTG
hide sequence
RefSeq Acc Id:
XM_039105369 ⟹ XP_038961297
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 34,087,709 - 34,113,465 (+) NCBI mRatBN7.2 3 13,689,742 - 13,715,652 (+) NCBI
RefSeq Acc Id:
NP_001102047 ⟸ NM_001108577
- UniProtKB:
B2RYQ2 (UniProtKB/TrEMBL), F7FF51 (UniProtKB/TrEMBL)
- Sequence:
MAEGERQPPPDSSEETPSATPTFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFDYKVSEAIEKLVALLDTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDQEAENLVATVIPTNL
hide sequence
Ensembl Acc Id:
ENSRNOP00000024914 ⟸ ENSRNOT00000024914
RefSeq Acc Id:
XP_038961297 ⟸ XM_039105369
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000080651 ⟸ ENSRNOT00000108795
Ensembl Acc Id:
ENSRNOP00000097534 ⟸ ENSRNOT00000118909
Ensembl Acc Id:
ENSRNOP00000097647 ⟸ ENSRNOT00000107089
Ensembl Acc Id:
ENSRNOP00000080286 ⟸ ENSRNOT00000108066
RGD ID: 13691960 Promoter ID: EPDNEW_R2485 Type: initiation region Name: Ptpa_1 Description: protein phosphatase 2 phosphatase activator SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 8,982,062 - 8,982,122 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-03
Ptpa
protein phosphatase 2 phosphatase activator
Ppp2r4
protein phosphatase 2 regulatory subunit 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-05-11
Ppp2r4
protein phosphatase 2 regulatory subunit 4
Ppp2r4
protein phosphatase 2A regulatory subunit 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-11-30
Ppp2r4
protein phosphatase 2A regulatory subunit 4
Ppp2r4
protein phosphatase 2A activator, regulatory subunit 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-12-15
Ppp2r4
protein phosphatase 2A activator, regulatory subunit 4
Ppp2r4
protein phosphatase 2A, regulatory subunit B (PR 53)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Ppp2r4
protein phosphatase 2A, regulatory subunit B (PR 53)
Ppp2r4_predicted
protein phosphatase 2A, regulatory subunit B (PR 53) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Ppp2r4_predicted
protein phosphatase 2A, regulatory subunit B' (PR 53) (predicted)
Symbol and Name status set to approved
70820 APPROVED
