Symbol:
Abcb8
Name:
ATP binding cassette subfamily B member 8
RGD ID:
1307655
Description:
Predicted to enable ATP binding activity and ATPase-coupled transmembrane transporter activity. Predicted to be involved in cell volume homeostasis and mitochondrial potassium ion transmembrane transport. Predicted to be located in mitochondrial inner membrane; nucleolus; and nucleoplasm. Predicted to be part of mitochondrial ATP-gated potassium channel complex. Predicted to be active in membrane and mitochondrion. Orthologous to human ABCB8 (ATP binding cassette subfamily B member 8); INTERACTS WITH 2,6-dinitrotoluene; 4,4'-sulfonyldiphenol; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ABC transporter 8; ATP-binding cassette sub-family B member 8, mitochondrial; ATP-binding cassette, sub-family B (MDR/TAP), member 8; ATP-binding cassette, sub-family B, member 8; ATP-binding cassette, subfamily B (MDR/TAP), member 8; LOC362302; MGC93731; mitochondrial potassium channel ATP-binding subunit; mitochondrial sulfonylurea-receptor; MITOSUR
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ABCB8 (ATP binding cassette subfamily B member 8) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Abcb8 (ATP-binding cassette, sub-family B member 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Abcb8 (ATP binding cassette subfamily B member 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ABCB8 (ATP binding cassette subfamily B member 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ABCB8 (ATP binding cassette subfamily B member 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Abcb8 (ATP binding cassette subfamily B member 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ABCB8 (ATP binding cassette subfamily B member 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ABCB8 (ATP binding cassette subfamily B member 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Abcb8 (ATP binding cassette subfamily B member 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ABCB8 (ATP binding cassette subfamily B member 8)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Abcb8 (ATP-binding cassette, sub-family B member 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
abcb8 (ATP-binding cassette, sub-family B (MDR/TAP), member 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG1824
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
haf-6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
abcb8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 11,660,716 - 11,676,030 (-) NCBI GRCr8 mRatBN7.2 4 10,766,206 - 10,783,598 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 10,768,281 - 10,783,589 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 15,915,187 - 15,929,761 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 11,735,380 - 11,749,954 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 10,087,164 - 10,101,738 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 7,296,538 - 7,311,856 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 7,296,209 - 7,311,878 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 7,307,902 - 7,323,217 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 6,133,928 - 6,148,509 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 6,133,927 - 6,148,509 (-) NCBI Celera 4 6,383,479 - 6,398,060 (-) NCBI Celera Cytogenetic Map 4 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Abcb8 Rat (1->4)-beta-D-glucan multiple interactions ISO Abcb8 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ABCB8 mRNA CTD PMID:36331819 Abcb8 Rat 1,2-dichloroethane decreases expression ISO Abcb8 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of ABCB8 mRNA CTD PMID:28960355 Abcb8 Rat 1,2-dimethylhydrazine multiple interactions ISO Abcb8 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ABCB8 mRNA] CTD PMID:22206623 Abcb8 Rat 1,2-dimethylhydrazine increases expression ISO Abcb8 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ABCB8 mRNA CTD PMID:22206623 Abcb8 Rat 17beta-estradiol increases expression ISO Abcb8 (Mus musculus) 6480464 Estradiol results in increased expression of ABCB8 mRNA CTD PMID:39298647 Abcb8 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Abcb8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ABCB8 mRNA CTD PMID:19933214 Abcb8 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Abcb8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ABCB8 mRNA CTD PMID:21570461 Abcb8 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ABCB8 mRNA CTD PMID:21346803 Abcb8 Rat 4,4'-sulfonyldiphenol increases expression ISO Abcb8 (Mus musculus) 6480464 bisphenol S results in increased expression of ABCB8 mRNA CTD PMID:39298647 Abcb8 Rat 4,4'-sulfonyldiphenol increases expression ISO ABCB8 (Homo sapiens) 6480464 bisphenol S results in increased expression of ABCB8 protein CTD PMID:34186270 Abcb8 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ABCB8 mRNA CTD PMID:36041667 Abcb8 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Abcb8 (Mus musculus) 6480464 bisphenol S results in decreased methylation of ABCB8 promoter CTD PMID:33297965 Abcb8 Rat 4,4'-sulfonyldiphenol affects expression ISO ABCB8 (Homo sapiens) 6480464 bisphenol S affects the expression of ABCB8 protein CTD PMID:31945527 Abcb8 Rat aflatoxin B1 increases methylation ISO ABCB8 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ABCB8 exon CTD PMID:30157460 Abcb8 Rat benzo[a]pyrene multiple interactions ISO Abcb8 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of ABCB8 mRNA] CTD PMID:22228805 Abcb8 Rat benzo[a]pyrene increases methylation ISO Abcb8 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of ABCB8 exon and Benzo(a)pyrene results in increased methylation of ABCB8 intron CTD PMID:27901495 Abcb8 Rat beta-lapachone increases expression ISO ABCB8 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ABCB8 mRNA CTD PMID:38218311 Abcb8 Rat beta-lapachone decreases expression ISO ABCB8 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of ABCB8 mRNA CTD PMID:38218311 Abcb8 Rat bis(2-ethylhexyl) phthalate increases expression ISO Abcb8 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ABCB8 mRNA CTD PMID:34319233 Abcb8 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ABCB8 mRNA CTD PMID:25181051 more ... Abcb8 Rat bisphenol A increases expression ISO ABCB8 (Homo sapiens) 6480464 bisphenol A results in increased expression of ABCB8 protein CTD PMID:34186270 Abcb8 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ABCB8 mRNA CTD PMID:36041667 Abcb8 Rat bisphenol A increases expression ISO Abcb8 (Mus musculus) 6480464 bisphenol A results in increased expression of ABCB8 mRNA CTD PMID:33221593 Abcb8 Rat bisphenol AF increases expression ISO ABCB8 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ABCB8 protein CTD PMID:34186270 Abcb8 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ABCB8 mRNA CTD PMID:36041667 Abcb8 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of ABCB8 promoter CTD PMID:22457795 Abcb8 Rat cadmium dichloride increases expression ISO ABCB8 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ABCB8 mRNA CTD PMID:38382870 Abcb8 Rat CGP 52608 multiple interactions ISO ABCB8 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ABCB8 gene] CTD PMID:28238834 Abcb8 Rat cisplatin multiple interactions ISO ABCB8 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of ABCB8 mRNA CTD PMID:27392435 Abcb8 Rat cisplatin decreases expression ISO ABCB8 (Homo sapiens) 6480464 Cisplatin results in decreased expression of ABCB8 mRNA CTD PMID:27392435 Abcb8 Rat cyclosporin A increases expression ISO Abcb8 (Mus musculus) 6480464 Cyclosporine results in increased expression of ABCB8 mRNA CTD PMID:19770486 Abcb8 Rat daunorubicin decreases expression EXP 6480464 Daunorubicin results in decreased expression of ABCB8 mRNA CTD PMID:27090888 Abcb8 Rat epoxiconazole decreases expression ISO Abcb8 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ABCB8 mRNA CTD PMID:35436446 Abcb8 Rat folic acid increases expression ISO Abcb8 (Mus musculus) 6480464 Folic Acid results in increased expression of ABCB8 mRNA CTD PMID:25629700 Abcb8 Rat folic acid multiple interactions ISO Abcb8 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ABCB8 mRNA] CTD PMID:22206623 Abcb8 Rat genistein decreases expression ISO Abcb8 (Mus musculus) 6480464 Genistein results in decreased expression of ABCB8 mRNA CTD PMID:32186404 Abcb8 Rat hydrogen cyanide decreases expression ISO Abcb8 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of ABCB8 mRNA CTD PMID:33914522 Abcb8 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ABCB8 mRNA CTD PMID:33387578 Abcb8 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Abcb8 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ABCB8 mRNA CTD PMID:36331819 Abcb8 Rat pirinixic acid increases expression ISO Abcb8 (Mus musculus) 6480464 pirinixic acid results in increased expression of ABCB8 mRNA CTD PMID:18301758 Abcb8 Rat potassium cyanide increases expression ISO Abcb8 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of ABCB8 mRNA CTD PMID:33914522 Abcb8 Rat sunitinib decreases expression ISO ABCB8 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ABCB8 mRNA CTD PMID:31533062 Abcb8 Rat trimellitic anhydride increases expression ISO Abcb8 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of ABCB8 mRNA CTD PMID:19042947 Abcb8 Rat valproic acid decreases expression ISO Abcb8 (Mus musculus) 6480464 Valproic Acid results in decreased expression of ABCB8 mRNA CTD PMID:21427059 Abcb8 Rat valproic acid increases methylation ISO ABCB8 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ABCB8 gene CTD PMID:29154799
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) aflatoxin B1 (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP) cadmium dichloride (EXP,ISO) CGP 52608 (ISO) cisplatin (ISO) cyclosporin A (ISO) daunorubicin (EXP) epoxiconazole (ISO) folic acid (ISO) genistein (ISO) hydrogen cyanide (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) potassium cyanide (ISO) sunitinib (ISO) trimellitic anhydride (ISO) valproic acid (ISO)
Cellular Component
membrane (IBA,IEA) mitochondrial ATP-gated potassium channel complex (IEA,ISO,ISS) mitochondrial inner membrane (IEA,ISO) mitochondrial membrane (IEA,ISO) mitochondrion (IBA,IEA,ISO,ISS) nucleolus (IEA,ISO) nucleoplasm (IEA,ISO)
Abcb8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 11,660,716 - 11,676,030 (-) NCBI GRCr8 mRatBN7.2 4 10,766,206 - 10,783,598 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 10,768,281 - 10,783,589 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 15,915,187 - 15,929,761 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 11,735,380 - 11,749,954 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 10,087,164 - 10,101,738 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 7,296,538 - 7,311,856 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 7,296,209 - 7,311,878 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 7,307,902 - 7,323,217 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 6,133,928 - 6,148,509 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 6,133,927 - 6,148,509 (-) NCBI Celera 4 6,383,479 - 6,398,060 (-) NCBI Celera Cytogenetic Map 4 q11 NCBI
ABCB8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 151,028,450 - 151,047,782 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 151,028,422 - 151,047,782 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 150,725,537 - 150,744,869 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 150,356,443 - 150,375,802 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 150,163,184 - 150,180,300 NCBI Celera 7 145,282,807 - 145,302,178 (+) NCBI Celera Cytogenetic Map 7 q36.1 NCBI HuRef 7 144,537,846 - 144,557,205 (+) NCBI HuRef CHM1_1 7 150,733,860 - 150,753,217 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 152,201,535 - 152,220,870 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 150,055,049 - 150,074,408 (+) NCBI
Abcb8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 24,598,679 - 24,617,757 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 24,598,661 - 24,615,052 (+) Ensembl GRCm39 Ensembl GRCm38 5 24,393,681 - 24,412,759 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 24,393,663 - 24,410,054 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 23,899,974 - 23,915,765 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 23,903,761 - 23,920,012 (+) NCBI MGSCv36 mm8 Celera 5 21,343,907 - 21,359,696 (+) NCBI Celera Cytogenetic Map 5 A3 NCBI cM Map 5 11.57 NCBI
Abcb8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955491 5,468,855 - 5,484,810 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955491 5,468,855 - 5,485,568 (+) NCBI ChiLan1.0 ChiLan1.0
ABCB8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 187,449,585 - 187,467,478 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 39,459,849 - 39,480,013 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 142,614,508 - 142,634,600 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 154,768,766 - 154,787,318 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 154,768,766 - 154,787,318 (+) Ensembl panpan1.1 panPan2
ABCB8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 15,082,866 - 15,098,928 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 15,082,917 - 15,096,593 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 15,691,137 - 15,706,215 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 16,805,113 - 16,820,196 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 16,805,126 - 16,819,985 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 15,177,557 - 15,192,635 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 15,759,004 - 15,773,961 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 15,809,718 - 15,824,796 (+) NCBI UU_Cfam_GSD_1.0
Abcb8 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 6,428,688 - 6,447,626 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936527 6,455,386 - 6,475,171 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936527 6,456,182 - 6,471,377 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ABCB8 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 6,178,554 - 6,197,226 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 6,178,550 - 6,197,012 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 6,548,585 - 6,567,048 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ABCB8 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 119,209,637 - 119,226,839 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 119,209,675 - 119,229,801 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666072 15,180,020 - 15,197,336 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Abcb8
.
Predicted Target Of
Count of predictions: 105 Count of miRNA genes: 80 Interacting mature miRNAs: 93 Transcripts: ENSRNOT00000012222 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2302371 Stl22 Serum triglyceride level QTL 22 5.15 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 57114705 Rat 8552903 Pigfal2 Plasma insulin-like growth factor 1 level QTL 2 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 4 1 31934116 Rat 724557 Plsm1 Polydactyly-luxate syndrome (PLS) morphotypes QTL 1 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 4 1 27716890 Rat 9590100 Sffal4 Serum free fatty acids level QTL 4 7.36 0.05 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 4 1 31934116 Rat 8552906 Pigfal3 Plasma insulin-like growth factor 1 level QTL 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 4 10084089 55084089 Rat 1357341 Gluco5 Glucose level QTL 5 6.4 adipocyte free fatty acid secretion trait (VT:0010465) absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446) 4 1 33250345 Rat 1357343 Gluco4 Glucose level QTL 4 0.00002 adipocyte glucose uptake trait (VT:0004185) adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874) 4 1 33250345 Rat 6478766 Anxrr47 Anxiety related response QTL 47 0.09637 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 10084089 55084089 Rat 631642 Stl2 Serum triglyceride level QTL 2 3.3 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5219178 56647776 Rat 6478769 Anxrr48 Anxiety related response QTL 48 0.02514 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 10084089 55084089 Rat 61333 Gluco16 Glucose level QTL 16 4.3 0.00001 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 1 30372989 Rat 634323 Hc2 Hypercalciuria QTL 2 2.15 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 4 210796 45210796 Rat 61408 Scl23 Serum cholesterol level QTL 23 0.0005 blood HDL phospholipid amount (VT:0010504) serum high density lipoprotein phospholipid level (CMO:0001567) 4 1 27716890 Rat 631209 Bw2 Body weight QTL2 4.2 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 9940885 44463908 Rat 8694374 Bw155 Body weight QTL 155 3.39 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 4 10084089 55084089 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 9589046 Scfw2 Subcutaneous fat weight QTL 2 5.54 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 4 1 31934116 Rat 6478724 Anxrr35 Anxiety related response QTL 35 0.00449 defecation behavior trait (VT:0010462) defecation measurement (CMO:0000997) 4 10084089 55084089 Rat 61351 Bp33 Blood pressure QTL 33 0.0018 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 1 27716890 Rat 61415 Eae11 Experimental allergic encephalomyelitis QTL 11 2.9 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 4 1 39505420 Rat 1641905 Colcr1 Colorectal carcinoma resistance QTL 1 4.3 0.0003 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 4 1 29494328 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 1358201 Gluco12 Glucose level QTL12 1.6 adipocyte glucose uptake trait (VT:0004185) adipocyte maximal glucose uptake (CMO:0000870) 4 5218392 29593287 Rat 738021 Hcar13 Hepatocarcinoma resistance QTL 13 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 4 1 32584199 Rat 1358203 Stl19 Serum triglyceride level QTL 19 2.8 0.002 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 65958103 Rat 9590304 Scort17 Serum corticosterone level QTL 17 4.96 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 10084089 55084089 Rat 9589097 Slep11 Serum leptin concentration QTL 11 5.09 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 4 1 31934116 Rat 1300141 Bp178 Blood pressure QTL 178 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 10024901 39524530 Rat
D4Rat250
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 11,673,721 - 11,673,930 (+) Marker Load Pipeline mRatBN7.2 4 10,781,285 - 10,781,494 (+) MAPPER mRatBN7.2 Rnor_6.0 4 7,309,543 - 7,309,751 NCBI Rnor6.0 Rnor_5.0 4 7,320,907 - 7,321,115 UniSTS Rnor5.0 RGSC_v3.4 4 6,146,301 - 6,146,510 RGD RGSC3.4 RGSC_v3.4 4 6,146,302 - 6,146,510 UniSTS RGSC3.4 RGSC_v3.1 4 6,146,301 - 6,146,510 RGD Celera 4 6,395,853 - 6,396,061 UniSTS RH 2.0 Map 4 47.7 RGD SHRSP x BN Map 4 0.0 RGD Cytogenetic Map 4 q11 UniSTS
RH124903
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 10,768,723 - 10,768,823 (+) MAPPER mRatBN7.2 Rnor_6.0 4 7,296,982 - 7,297,081 NCBI Rnor6.0 Rnor_5.0 4 7,308,346 - 7,308,445 UniSTS Rnor5.0 RGSC_v3.4 4 6,133,741 - 6,133,840 UniSTS RGSC3.4 Celera 4 6,383,292 - 6,383,391 UniSTS Cytogenetic Map 4 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012222 ⟹ ENSRNOP00000012222
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 10,768,281 - 10,783,574 (-) Ensembl Rnor_6.0 Ensembl 4 7,296,629 - 7,311,807 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000089817 ⟹ ENSRNOP00000071952
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 10,768,367 - 10,783,589 (-) Ensembl Rnor_6.0 Ensembl 4 7,296,209 - 7,311,878 (-) Ensembl
RefSeq Acc Id:
NM_001007796 ⟹ NP_001007797
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 11,660,716 - 11,676,002 (-) NCBI mRatBN7.2 4 10,768,279 - 10,783,566 (-) NCBI Rnor_6.0 4 7,297,169 - 7,311,750 (-) NCBI Rnor_5.0 4 7,307,902 - 7,323,217 (-) NCBI RGSC_v3.4 4 6,133,928 - 6,148,509 (-) RGD Celera 4 6,383,479 - 6,398,060 (-) RGD
Sequence:
ATGTTGGTGCACTTATTTCGGGTCGGAATTCGGGGTGGCCCAGTTCCAAGATGGTCGCTACAATCCCTGCGCTTCCAGACGTTCTCAGCCGCCAGGTCCTCAGATGACCAGTTCAGCTCATGCCTCCT
hide sequence
RefSeq Acc Id:
XM_006235946 ⟹ XP_006236008
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 11,660,717 - 11,676,030 (-) NCBI mRatBN7.2 4 10,766,206 - 10,783,598 (-) NCBI Rnor_6.0 4 7,296,538 - 7,311,856 (-) NCBI Rnor_5.0 4 7,307,902 - 7,323,217 (-) NCBI
Sequence:
GAGGTGAGAAGAGGTTGTCGGGATGGGGGCCATAGCTAACATGGAACCCTCGGTAGGATAAGTGTGAGATTGCCGTTGCTGGCTGTCCCTGTTTTATTGCCTCAACATGTTGGTGCACTTATTTCGGG
hide sequence
RefSeq Acc Id:
XM_039107751 ⟹ XP_038963679
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 11,660,717 - 11,676,030 (-) NCBI mRatBN7.2 4 10,766,206 - 10,783,597 (-) NCBI
RefSeq Acc Id:
XM_039107752 ⟹ XP_038963680
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 11,660,717 - 11,670,789 (-) NCBI mRatBN7.2 4 10,766,206 - 10,778,357 (-) NCBI
RefSeq Acc Id:
XM_063286228 ⟹ XP_063142298
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 11,660,717 - 11,670,719 (-) NCBI
RefSeq Acc Id:
XM_063286229 ⟹ XP_063142299
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 11,660,717 - 11,670,778 (-) NCBI
RefSeq Acc Id:
NP_001007797 ⟸ NM_001007796
- Peptide Label:
precursor
- UniProtKB:
Q0QVT4 (UniProtKB/Swiss-Prot), Q5RKI8 (UniProtKB/Swiss-Prot), A0A0H2UHH3 (UniProtKB/TrEMBL)
- Sequence:
MLVHLFRVGIRGGPVPRWSLQSLRFQTFSAARSSDDQFSSCLLRAVAQLRSQLRAHLPRSPPASHRSTSAWCWVGGTLVVPAVLWQHPRFCLIALCEAKGSPPAQPTRARELRFKWKLFWHFLHPHLL
hide sequence
RefSeq Acc Id:
XP_006236008 ⟸ XM_006235946
- Peptide Label:
isoform X1
- UniProtKB:
A0A0H2UHH3 (UniProtKB/TrEMBL)
- Sequence:
MVATIPALPDVLSRQLALGAALVNVQIPLLLGQLVEIVAKYTREHVGSFVSESRRLSIQLLLLYGVQGLLTFGYLVLLSHMGERMAMDMRKALFSSLLRQDIAFFDAKKTGQLVSRLTTDVQEFKSSF
hide sequence
Ensembl Acc Id:
ENSRNOP00000012222 ⟸ ENSRNOT00000012222
Ensembl Acc Id:
ENSRNOP00000071952 ⟸ ENSRNOT00000089817
RefSeq Acc Id:
XP_038963679 ⟸ XM_039107751
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038963680 ⟸ XM_039107752
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063142299 ⟸ XM_063286229
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063142298 ⟸ XM_063286228
- Peptide Label:
isoform X2
RGD ID: 13692801 Promoter ID: EPDNEW_R3317 Type: multiple initiation site Name: Abcb8_1 Description: ATP binding cassette subfamily B member 8 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 7,311,825 - 7,311,885 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-09
Abcb8
ATP binding cassette subfamily B member 8
Abcb8
ATP-binding cassette, subfamily B (MDR/TAP), member 8
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-11-16
Abcb8
ATP-binding cassette, subfamily B (MDR/TAP), member 8
Abcb8
ATP-binding cassette, sub-family B (MDR/TAP), member 8
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Abcb8
ATP-binding cassette, sub-family B (MDR/TAP), member 8
Abcb8_predicted
ATP-binding cassette, sub-family B (MDR/TAP), member 8 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Abcb8_predicted
ATP-binding cassette, sub-family B (MDR/TAP), member 8 (predicted)
Symbol and Name status set to approved
70820 APPROVED
