Symbol:
Sh2d3c
Name:
SH2 domain containing 3C
RGD ID:
1307287
Description:
Predicted to enable guanyl-nucleotide exchange factor activity and phosphotyrosine residue binding activity. Predicted to be involved in small GTPase-mediated signal transduction. Predicted to be located in cytosol. Orthologous to human SH2D3C (SH2 domain containing 3C); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC362111; NSP3; SH2 domain-containing protein 3C
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 36,408,305 - 36,444,191 (+) NCBI GRCr8 mRatBN7.2 3 16,010,622 - 16,046,491 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 16,010,625 - 16,046,484 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 19,078,919 - 19,114,707 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 27,663,924 - 27,699,712 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 25,915,240 - 25,951,556 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 11,756,427 - 11,793,547 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 11,756,384 - 11,793,593 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 17,095,296 - 17,130,517 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 11,687,031 - 11,731,868 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 11,617,288 - 11,627,810 (+) NCBI Celera 3 10,751,515 - 10,786,059 (+) NCBI Celera Cytogenetic Map 3 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sh2d3c Rat (1->4)-beta-D-glucan multiple interactions ISO Sh2d3c (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SH2D3C mRNA CTD PMID:36331819 Sh2d3c Rat 17alpha-ethynylestradiol affects expression ISO Sh2d3c (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of SH2D3C mRNA CTD PMID:17555576 Sh2d3c Rat 17beta-estradiol multiple interactions ISO SH2D3C (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of SH2D3C mRNA and Estradiol promotes the reaction [ESR2 protein affects the expression of SH2D3C mRNA] CTD PMID:20404318 Sh2d3c Rat 17beta-estradiol increases expression ISO SH2D3C (Homo sapiens) 6480464 Estradiol results in increased expression of SH2D3C mRNA CTD PMID:31614463 Sh2d3c Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SH2D3C mRNA CTD PMID:32741896 Sh2d3c Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SH2D3C mRNA CTD PMID:32741896 Sh2d3c Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Sh2d3c (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Sh2d3c Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SH2D3C mRNA CTD PMID:22298810 and PMID:34747641 Sh2d3c Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Sh2d3c (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SH2D3C mRNA CTD PMID:21354282 Sh2d3c Rat 4,4'-diaminodiphenylmethane decreases expression ISO Sh2d3c (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of SH2D3C mRNA CTD PMID:18648102 Sh2d3c Rat 4,4'-sulfonyldiphenol decreases methylation ISO Sh2d3c (Mus musculus) 6480464 bisphenol S results in decreased methylation of SH2D3C exon CTD PMID:33297965 Sh2d3c Rat 4,4'-sulfonyldiphenol affects methylation ISO Sh2d3c (Mus musculus) 6480464 bisphenol S affects the methylation of SH2D3C gene CTD PMID:31683443 Sh2d3c Rat 4-hydroxyphenyl retinamide increases expression ISO Sh2d3c (Mus musculus) 6480464 Fenretinide results in increased expression of SH2D3C mRNA CTD PMID:28973697 Sh2d3c Rat 5-aza-2'-deoxycytidine affects expression ISO SH2D3C (Homo sapiens) 6480464 Decitabine affects the expression of SH2D3C mRNA CTD PMID:23300844 Sh2d3c Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SH2D3C mRNA CTD PMID:24780913 Sh2d3c Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SH2D3C mRNA CTD PMID:31881176 Sh2d3c Rat acrylamide decreases expression ISO SH2D3C (Homo sapiens) 6480464 Acrylamide results in decreased expression of SH2D3C mRNA CTD PMID:32763439 Sh2d3c Rat all-trans-retinoic acid increases expression ISO SH2D3C (Homo sapiens) 6480464 Tretinoin results in increased expression of SH2D3C mRNA CTD PMID:33167477 Sh2d3c Rat arsane affects expression ISO SH2D3C (Homo sapiens) 6480464 Arsenic affects the expression of SH2D3C mRNA CTD PMID:18414638 Sh2d3c Rat arsenic atom affects expression ISO SH2D3C (Homo sapiens) 6480464 Arsenic affects the expression of SH2D3C mRNA CTD PMID:18414638 Sh2d3c Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of SH2D3C mRNA CTD PMID:36841081 Sh2d3c Rat benzo[a]pyrene affects methylation ISO SH2D3C (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SH2D3C promoter CTD PMID:27901495 Sh2d3c Rat benzo[a]pyrene decreases methylation ISO Sh2d3c (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of SH2D3C exon and Benzo(a)pyrene results in decreased methylation of SH2D3C intron CTD PMID:27901495 Sh2d3c Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SH2D3C mRNA CTD PMID:25181051 Sh2d3c Rat bisphenol A increases expression ISO SH2D3C (Homo sapiens) 6480464 bisphenol A results in increased expression of SH2D3C mRNA CTD PMID:27685785 Sh2d3c Rat bisphenol F decreases expression ISO Sh2d3c (Mus musculus) 6480464 bisphenol F results in decreased expression of SH2D3C mRNA CTD PMID:38685157 Sh2d3c Rat bortezomib decreases expression ISO SH2D3C (Homo sapiens) 6480464 Bortezomib results in decreased expression of SH2D3C mRNA CTD PMID:20977926 Sh2d3c Rat butanal increases expression ISO SH2D3C (Homo sapiens) 6480464 butyraldehyde results in increased expression of SH2D3C mRNA CTD PMID:26079696 Sh2d3c Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of SH2D3C mRNA CTD PMID:19167457 Sh2d3c Rat CGP 52608 multiple interactions ISO SH2D3C (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SH2D3C gene] CTD PMID:28238834 Sh2d3c Rat chlorpyrifos increases expression ISO Sh2d3c (Mus musculus) 6480464 Chlorpyrifos results in increased expression of SH2D3C mRNA CTD PMID:37019170 Sh2d3c Rat cisplatin affects expression ISO SH2D3C (Homo sapiens) 6480464 Cisplatin affects the expression of SH2D3C mRNA CTD PMID:23300844 Sh2d3c Rat deoxynivalenol affects phosphorylation ISO Sh2d3c (Mus musculus) 6480464 deoxynivalenol affects the phosphorylation of SH2D3C protein CTD PMID:23811945 Sh2d3c Rat diallyl disulfide multiple interactions ISO SH2D3C (Homo sapiens) 6480464 diallyl disulfide inhibits the reaction [tobacco tar analog results in decreased expression of SH2D3C mRNA] CTD PMID:36758788 Sh2d3c Rat Diallyl sulfide multiple interactions ISO SH2D3C (Homo sapiens) 6480464 allyl sulfide inhibits the reaction [tobacco tar analog results in decreased expression of SH2D3C mRNA] CTD PMID:36758788 Sh2d3c Rat doxorubicin decreases expression ISO SH2D3C (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SH2D3C mRNA CTD PMID:29803840 Sh2d3c Rat epoxiconazole decreases expression ISO Sh2d3c (Mus musculus) 6480464 epoxiconazole results in decreased expression of SH2D3C mRNA CTD PMID:35436446 Sh2d3c Rat formaldehyde decreases expression ISO SH2D3C (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SH2D3C mRNA CTD PMID:27905399 Sh2d3c Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SH2D3C mRNA CTD PMID:22061828 Sh2d3c Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of SH2D3C mRNA CTD PMID:24915197 Sh2d3c Rat inulin multiple interactions ISO Sh2d3c (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SH2D3C mRNA CTD PMID:36331819 Sh2d3c Rat iron dichloride increases expression ISO SH2D3C (Homo sapiens) 6480464 ferrous chloride results in increased expression of SH2D3C mRNA CTD PMID:35984750 Sh2d3c Rat lead(0) increases expression ISO SH2D3C (Homo sapiens) 6480464 Lead results in increased expression of SH2D3C mRNA CTD PMID:19921347 Sh2d3c Rat lipopolysaccharide multiple interactions ISO SH2D3C (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Sh2d3c Rat lipopolysaccharide decreases expression ISO SH2D3C (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of SH2D3C mRNA CTD PMID:35811015 Sh2d3c Rat manganese atom multiple interactions ISO Sh2d3c (Mus musculus) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SH2D3C mRNA CTD PMID:35690225 Sh2d3c Rat manganese(0) multiple interactions ISO Sh2d3c (Mus musculus) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SH2D3C mRNA CTD PMID:35690225 Sh2d3c Rat manganese(II) chloride multiple interactions ISO Sh2d3c (Mus musculus) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SH2D3C mRNA CTD PMID:35690225 Sh2d3c Rat methamphetamine increases expression ISO Sh2d3c (Mus musculus) 6480464 Methamphetamine results in increased expression of SH2D3C mRNA CTD PMID:26307267 Sh2d3c Rat methyl methanesulfonate decreases expression ISO SH2D3C (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SH2D3C mRNA CTD PMID:23649840 Sh2d3c Rat methylmercury chloride increases expression ISO SH2D3C (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SH2D3C mRNA CTD PMID:28001369 Sh2d3c Rat nickel atom decreases expression ISO SH2D3C (Homo sapiens) 6480464 Nickel results in decreased expression of SH2D3C mRNA CTD PMID:23195993 Sh2d3c Rat ozone multiple interactions ISO Sh2d3c (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of SH2D3C mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of SH2D3C mRNA CTD PMID:34911549 Sh2d3c Rat paracetamol decreases expression ISO SH2D3C (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SH2D3C mRNA CTD PMID:22230336 Sh2d3c Rat pentanal increases expression ISO SH2D3C (Homo sapiens) 6480464 pentanal results in increased expression of SH2D3C mRNA CTD PMID:26079696 Sh2d3c Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Sh2d3c (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SH2D3C mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SH2D3C mRNA CTD PMID:36331819 Sh2d3c Rat pirinixic acid multiple interactions ISO Sh2d3c (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of SH2D3C mRNA CTD PMID:19710929 Sh2d3c Rat pirinixic acid decreases expression ISO Sh2d3c (Mus musculus) 6480464 pirinixic acid results in decreased expression of SH2D3C mRNA CTD PMID:23811191 Sh2d3c Rat propanal increases expression ISO SH2D3C (Homo sapiens) 6480464 propionaldehyde results in increased expression of SH2D3C mRNA CTD PMID:26079696 Sh2d3c Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SH2D3C (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Sh2d3c Rat sodium arsenite increases expression ISO SH2D3C (Homo sapiens) 6480464 sodium arsenite results in increased expression of SH2D3C mRNA CTD PMID:38568856 Sh2d3c Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SH2D3C mRNA CTD PMID:32741896 Sh2d3c Rat titanium dioxide decreases expression ISO Sh2d3c (Mus musculus) 6480464 titanium dioxide results in decreased expression of SH2D3C mRNA CTD PMID:23557971 Sh2d3c Rat titanium dioxide decreases methylation ISO Sh2d3c (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SH2D3C gene CTD PMID:35295148 Sh2d3c Rat triphenyl phosphate affects expression ISO SH2D3C (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SH2D3C mRNA CTD PMID:37042841 Sh2d3c Rat triptonide increases expression ISO Sh2d3c (Mus musculus) 6480464 triptonide results in increased expression of SH2D3C mRNA CTD PMID:33045310 Sh2d3c Rat valproic acid increases expression ISO Sh2d3c (Mus musculus) 6480464 Valproic Acid results in increased expression of SH2D3C mRNA CTD PMID:19136453 and PMID:21427059 Sh2d3c Rat valproic acid affects expression ISO Sh2d3c (Mus musculus) 6480464 Valproic Acid affects the expression of SH2D3C mRNA CTD PMID:17292431 and PMID:17963808 Sh2d3c Rat valproic acid increases methylation ISO SH2D3C (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SH2D3C gene CTD PMID:29154799 Sh2d3c Rat valproic acid increases expression ISO SH2D3C (Homo sapiens) 6480464 Valproic Acid results in increased expression of SH2D3C mRNA CTD PMID:28001369
(1->4)-beta-D-glucan (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bortezomib (ISO) butanal (ISO) C60 fullerene (EXP) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (ISO) deoxynivalenol (ISO) diallyl disulfide (ISO) Diallyl sulfide (ISO) doxorubicin (ISO) epoxiconazole (ISO) formaldehyde (ISO) gentamycin (EXP) glycidol (EXP) inulin (ISO) iron dichloride (ISO) lead(0) (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) nickel atom (ISO) ozone (ISO) paracetamol (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) propanal (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) testosterone (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO)
Sh2d3c Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 36,408,305 - 36,444,191 (+) NCBI GRCr8 mRatBN7.2 3 16,010,622 - 16,046,491 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 16,010,625 - 16,046,484 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 19,078,919 - 19,114,707 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 27,663,924 - 27,699,712 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 25,915,240 - 25,951,556 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 11,756,427 - 11,793,547 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 11,756,384 - 11,793,593 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 17,095,296 - 17,130,517 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 11,687,031 - 11,731,868 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 11,617,288 - 11,627,810 (+) NCBI Celera 3 10,751,515 - 10,786,059 (+) NCBI Celera Cytogenetic Map 3 p11 NCBI
SH2D3C Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 127,738,317 - 127,778,666 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 127,738,317 - 127,778,710 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 130,500,596 - 130,540,945 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 129,540,419 - 129,580,733 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 9 101,151,465 - 101,191,912 (-) NCBI Celera Cytogenetic Map 9 q34.11 NCBI HuRef 9 100,117,130 - 100,157,604 (-) NCBI HuRef CHM1_1 9 130,652,151 - 130,692,598 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 139,945,763 - 139,986,120 (-) NCBI T2T-CHM13v2.0
Sh2d3c Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 32,611,072 - 32,645,008 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 32,611,067 - 32,645,524 (+) Ensembl GRCm39 Ensembl GRCm38 2 32,721,037 - 32,755,007 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 32,721,055 - 32,755,512 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 32,576,592 - 32,610,514 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 32,543,081 - 32,577,003 (+) NCBI MGSCv36 mm8 Celera 2 32,427,779 - 32,461,735 (+) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 22.09 NCBI
Sh2d3c Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 891,133 - 921,062 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 891,133 - 921,062 (+) NCBI ChiLan1.0 ChiLan1.0
SH2D3C Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 11,569,377 - 11,616,556 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 11,571,776 - 11,618,903 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 98,858,018 - 98,899,661 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 127,530,733 - 127,571,016 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 127,530,733 - 127,571,016 (-) Ensembl panpan1.1 panPan2
SH2D3C Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 55,626,379 - 55,656,667 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 55,626,360 - 55,656,507 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 54,819,942 - 54,850,176 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 56,547,903 - 56,578,173 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 56,547,816 - 56,578,171 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 55,308,165 - 55,338,424 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 55,622,873 - 55,653,134 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 55,714,308 - 55,744,373 (+) NCBI UU_Cfam_GSD_1.0
Sh2d3c Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 195,642,351 - 195,671,839 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936487 15,410,877 - 15,440,347 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936487 15,410,878 - 15,440,326 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SH2D3C Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 268,238,973 - 268,270,361 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 268,238,967 - 268,270,395 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 302,129,597 - 302,137,809 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SH2D3C Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 10,352,947 - 10,395,023 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 10,354,061 - 10,396,230 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666079 5,826,055 - 5,867,966 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sh2d3c
.
Predicted Target Of
Count of predictions: 160 Count of miRNA genes: 129 Interacting mature miRNAs: 146 Transcripts: ENSRNOT00000031511, ENSRNOT00000065915 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358357 Srcrtb1 Stress Responsive Cort Basal QTL 1 6.36 0.002 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 8658162 27494778 Rat 6893355 Bw101 Body weight QTL 101 0.4 0.38 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 1298526 Arunc3 Aerobic running capacity QTL 3 2.2 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 8227194 33703538 Rat 8693641 Alc30 Alcohol consumption QTL 30 2 0.739 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 3 10434306 24512004 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1558657 Cm43 Cardiac mass QTL 43 6.6 3e-08 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 631568 Bp92 Blood pressure QTL 92 2.2 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 39874793 Rat 6893363 Bw105 Body weight QTL 105 2.6 0.0036 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 61468 Bp15 Blood pressure QTL 15 4.4 blood pressure trait (VT:0000183) pulse pressure (CMO:0000292) 3 1 33278763 Rat 631831 Alc8 Alcohol consumption QTL 8 2.7 consumption behavior trait (VT:0002069) calculated ethanol drink intake rate (CMO:0001615) 3 1 33230976 Rat 1558647 Cm46 Cardiac mass QTL 46 5.4 0.0000055 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 4889966 Bss95 Bone structure and strength QTL 95 4.4 tibia area (VT:1000281) tibia-fibula cross-sectional area (CMO:0001718) 3 1 36847613 Rat 1558654 Bw56 Body weight QTL 56 4.5 0.0000171 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 1558650 Cm48 Cardiac mass QTL 48 4 0.0001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 3 10778823 30356773 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 631545 Bp85 Blood pressure QTL 85 3.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 33278763 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 631679 Cm10 Cardiac mass QTL 10 7.34 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 1 31158234 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 70203 Gcr2 Gastric cancer resistance QTL 2 2.6 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 3 8658162 27494778 Rat 70202 Alc19 Alcohol consumption QTL 19 2.5 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 3 1 27494778 Rat 2312664 Scl62 Serum cholesterol level QTL 62 0.05 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 1 38710544 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat
RH127491
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 16,046,208 - 16,046,413 (+) MAPPER mRatBN7.2 Rnor_6.0 3 11,793,272 - 11,793,476 NCBI Rnor6.0 Rnor_5.0 3 17,130,242 - 17,130,446 UniSTS Rnor5.0 RGSC_v3.4 3 11,731,593 - 11,731,797 UniSTS RGSC3.4 Celera 3 10,785,784 - 10,785,988 UniSTS RH 3.4 Map 3 71.1 UniSTS Cytogenetic Map 3 p11 UniSTS
RH138706
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 16,036,423 - 16,036,650 (+) MAPPER mRatBN7.2 Rnor_6.0 3 11,783,487 - 11,783,713 NCBI Rnor6.0 Rnor_5.0 3 17,120,457 - 17,120,683 UniSTS Rnor5.0 RGSC_v3.4 3 11,721,808 - 11,722,034 UniSTS RGSC3.4 Celera 3 10,775,999 - 10,776,225 UniSTS RH 3.4 Map 3 60.6 UniSTS Cytogenetic Map 3 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000078366 ⟹ ENSRNOP00000072798
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 16,017,500 - 16,046,484 (+) Ensembl Rnor_6.0 Ensembl 3 11,763,706 - 11,793,547 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000087762 ⟹ ENSRNOP00000070659
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 16,010,625 - 16,046,484 (+) Ensembl Rnor_6.0 Ensembl 3 11,756,384 - 11,793,593 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000098941 ⟹ ENSRNOP00000079271
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 16,034,838 - 16,041,141 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106524 ⟹ ENSRNOP00000084559
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 16,034,838 - 16,046,484 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110408 ⟹ ENSRNOP00000078942
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 16,017,500 - 16,046,484 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113142 ⟹ ENSRNOP00000088575
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 16,014,594 - 16,046,484 (+) Ensembl
RefSeq Acc Id:
NM_001108579 ⟹ NP_001102049
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 36,408,326 - 36,444,191 (+) NCBI mRatBN7.2 3 16,010,625 - 16,046,484 (+) NCBI Rnor_6.0 3 11,756,427 - 11,793,547 (+) NCBI Rnor_5.0 3 17,095,296 - 17,130,517 (+) NCBI RGSC_v3.4 3 11,687,031 - 11,731,868 (+) RGD Celera 3 10,751,515 - 10,786,059 (+) RGD
Sequence:
GAGCCGAGGAGGCTGGTCAGCCCCGATGCCTTGAGCCTGGAACAGCCACATGCTAGCAAACCAGGGACTTTGCACAACTTGCCAAGATGACAGAAATGCCCAAGAAAACAGGCAAAAAGTTCAAGTTC
hide sequence
RefSeq Acc Id:
XM_008761759 ⟹ XP_008759981
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 36,415,038 - 36,444,191 (+) NCBI mRatBN7.2 3 16,017,336 - 16,046,491 (+) NCBI Rnor_6.0 3 11,762,339 - 11,793,547 (+) NCBI
Sequence:
TGTTTGGTTTTGTTTTTTGGAGACAAGGTTTCTCTGGGTAGCCTTGGCAGTCCTGGAAATCGCT
hide sequence
RefSeq Acc Id:
XM_008761760 ⟹ XP_008759982
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 36,425,248 - 36,444,191 (+) NCBI mRatBN7.2 3 16,030,174 - 16,046,491 (+) NCBI Rnor_6.0 3 11,777,946 - 11,793,547 (+) NCBI
Sequence:
AAAAAAAAAAAAAAAGATATAGATTTCAGGGCTGTGGATGTAGCTGGGGAAACAACTGTTTCCA
hide sequence
RefSeq Acc Id:
XM_017591882 ⟹ XP_017447371
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 36,425,248 - 36,444,191 (+) NCBI mRatBN7.2 3 16,030,174 - 16,046,491 (+) NCBI Rnor_6.0 3 11,777,946 - 11,793,547 (+) NCBI
Sequence:
AAAAAAAAAAAAAAAGATATAGATTTCAGGGCTGTGGATGTAGCTGGGGAAACAACTGTTTCCA
hide sequence
RefSeq Acc Id:
XM_039105377 ⟹ XP_038961305
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 36,408,305 - 36,444,191 (+) NCBI mRatBN7.2 3 16,010,622 - 16,046,491 (+) NCBI
RefSeq Acc Id:
XM_039105378 ⟹ XP_038961306
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 36,430,103 - 36,444,191 (+) NCBI mRatBN7.2 3 16,032,393 - 16,046,491 (+) NCBI
RefSeq Acc Id:
XM_063284070 ⟹ XP_063140140
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 36,415,285 - 36,444,191 (+) NCBI
RefSeq Acc Id:
NP_001102049 ⟸ NM_001108579
- UniProtKB:
A0A0G2JYH7 (UniProtKB/TrEMBL), A6JU82 (UniProtKB/TrEMBL), A0A8I6A5D5 (UniProtKB/TrEMBL)
- Sequence:
MTEMPKKTGKKFKFFKFKGLGSLSNLPRSFSLRRSSASPSIRSCPEPDTFEATQDDLVTLPKSPPAYARSSDMYSHMGTMPRPNIKKAQKQKAVQKAQEVSRESHLVSRGLPEPPDFEAAKEAEKGTE
hide sequence
RefSeq Acc Id:
XP_008759981 ⟸ XM_008761759
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZME7 (UniProtKB/TrEMBL), A0A2Z5DT54 (UniProtKB/TrEMBL)
- Sequence:
MTAVGRRCSALGARRAAAELEAAGDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWHNQTLHFKINKVVVEAGESYTHIRYLF
hide sequence
RefSeq Acc Id:
XP_008759982 ⟸ XM_008761760
- Peptide Label:
isoform X3
- UniProtKB:
A0A2Z5DT54 (UniProtKB/TrEMBL)
- Sequence:
MTERCSLWSALSAAACCFYRGSLVQVQFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYH
hide sequence
RefSeq Acc Id:
XP_017447371 ⟸ XM_017591882
- Peptide Label:
isoform X4
- UniProtKB:
A0A2Z5DT54 (UniProtKB/TrEMBL)
- Sequence:
MTERCSLWSALSAAACCFYRGSLFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWHNQTLHFKINKVVVEAGESYTHIRYLFEQESF
hide sequence
Ensembl Acc Id:
ENSRNOP00000070659 ⟸ ENSRNOT00000087762
Ensembl Acc Id:
ENSRNOP00000072798 ⟸ ENSRNOT00000078366
RefSeq Acc Id:
XP_038961305 ⟸ XM_039105377
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A5D5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961306 ⟸ XM_039105378
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6GAN0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000088575 ⟸ ENSRNOT00000113142
Ensembl Acc Id:
ENSRNOP00000084559 ⟸ ENSRNOT00000106524
Ensembl Acc Id:
ENSRNOP00000078942 ⟸ ENSRNOT00000110408
Ensembl Acc Id:
ENSRNOP00000079271 ⟸ ENSRNOT00000098941
RefSeq Acc Id:
XP_063140140 ⟸ XM_063284070
- Peptide Label:
isoform X6
RGD ID: 13692001 Promoter ID: EPDNEW_R2517 Type: single initiation site Name: Sh2d3c_1 Description: SH2 domain containing 3C SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 11,763,690 - 11,763,750 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Sh2d3c
SH2 domain containing 3C
Sh2d3c_predicted
SH2 domain containing 3C (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Sh2d3c_predicted
SH2 domain containing 3C (predicted)
Symbol and Name status set to approved
70820 APPROVED
