Symbol:
Mrpl18
Name:
mitochondrial ribosomal protein L18
RGD ID:
1306387
Description:
Predicted to enable 5S rRNA binding activity. Predicted to be involved in rRNA import into mitochondrion. Predicted to be located in mitochondrion. Predicted to be part of mitochondrial large ribosomal subunit. Orthologous to human MRPL18 (mitochondrial ribosomal protein L18); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
39S ribosomal protein L18, mitochondrial; large ribosomal subunit protein uL18m; LOC292244
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MRPL18 (mitochondrial ribosomal protein L18) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mrpl18 (mitochondrial ribosomal protein L18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mrpl18 (mitochondrial ribosomal protein L18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MRPL18 (mitochondrial ribosomal protein L18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MRPL18 (mitochondrial ribosomal protein L18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mrpl18 (mitochondrial ribosomal protein L18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MRPL18 (mitochondrial ribosomal protein L18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MRPL18 (mitochondrial ribosomal protein L18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mrpl18 (mitochondrial ribosomal protein L18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SPAG7 (sperm associated antigen 7) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
MRPL18 (mitochondrial ribosomal protein L18)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mrpl18 (mitochondrial ribosomal protein L18)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mrpl18 (mitochondrial ribosomal protein L18)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mrpl-18
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
mRpL18
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mrpl18
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 50,384,951 - 50,389,769 (+) NCBI GRCr8 mRatBN7.2 1 47,837,169 - 47,841,987 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 47,836,561 - 47,841,987 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 48,528,807 - 48,533,628 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 54,514,771 - 54,519,522 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 48,604,336 - 48,609,149 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 48,033,531 - 48,038,726 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 48,033,768 - 48,038,726 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 51,713,672 - 51,718,630 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 42,111,647 - 42,116,465 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 42,114,536 - 42,119,412 (+) NCBI Celera 1 43,637,628 - 43,642,435 (+) NCBI Celera Cytogenetic Map 1 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mrpl18 Rat 1,2-dimethylhydrazine decreases expression ISO Mrpl18 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MRPL18 mRNA CTD PMID:22206623 Mrpl18 Rat 1,2-dimethylhydrazine multiple interactions ISO Mrpl18 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MRPL18 mRNA CTD PMID:22206623 Mrpl18 Rat 17alpha-ethynylestradiol affects expression ISO Mrpl18 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of MRPL18 mRNA CTD PMID:17555576 Mrpl18 Rat 17beta-estradiol increases expression ISO MRPL18 (Homo sapiens) 6480464 Estradiol results in increased expression of MRPL18 mRNA CTD PMID:20106945 Mrpl18 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MRPL18 mRNA CTD PMID:22298810 Mrpl18 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mrpl18 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MRPL18 mRNA CTD PMID:21570461 Mrpl18 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MRPL18 mRNA CTD PMID:21215274 Mrpl18 Rat 2-methylcholine affects expression ISO MRPL18 (Homo sapiens) 6480464 beta-methylcholine affects the expression of MRPL18 mRNA CTD PMID:21179406 Mrpl18 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Mrpl18 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of MRPL18 mRNA CTD PMID:18648102 Mrpl18 Rat 4,4'-sulfonyldiphenol increases expression ISO Mrpl18 (Mus musculus) 6480464 bisphenol S results in increased expression of MRPL18 mRNA CTD PMID:39298647 Mrpl18 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MRPL18 mRNA CTD PMID:25825206 Mrpl18 Rat acrylamide increases expression ISO MRPL18 (Homo sapiens) 6480464 Acrylamide results in increased expression of MRPL18 mRNA CTD PMID:32763439 Mrpl18 Rat aflatoxin B1 increases expression ISO Mrpl18 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of MRPL18 mRNA CTD PMID:19770486 Mrpl18 Rat aflatoxin B1 increases methylation ISO MRPL18 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MRPL18 gene CTD PMID:27153756 Mrpl18 Rat aflatoxin B1 increases expression ISO MRPL18 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of MRPL18 mRNA CTD PMID:27153756 Mrpl18 Rat all-trans-retinoic acid decreases expression ISO MRPL18 (Homo sapiens) 6480464 Tretinoin results in decreased expression of MRPL18 mRNA CTD PMID:33167477 Mrpl18 Rat arsenite(3-) multiple interactions ISO MRPL18 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to MRPL18 mRNA] CTD PMID:32406909 Mrpl18 Rat atrazine decreases expression ISO MRPL18 (Homo sapiens) 6480464 Atrazine results in decreased expression of MRPL18 mRNA CTD PMID:22378314 Mrpl18 Rat benzo[a]pyrene increases expression ISO MRPL18 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MRPL18 mRNA CTD PMID:20106945 Mrpl18 Rat beta-lapachone decreases expression ISO MRPL18 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of MRPL18 mRNA CTD PMID:38218311 Mrpl18 Rat bilirubin IXalpha decreases expression ISO MRPL18 (Homo sapiens) 6480464 Bilirubin results in decreased expression of MRPL18 mRNA CTD PMID:20196124 Mrpl18 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MRPL18 mRNA CTD PMID:25181051 Mrpl18 Rat bisphenol A decreases methylation ISO MRPL18 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of MRPL18 gene CTD PMID:31601247 Mrpl18 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of MRPL18 mRNA CTD PMID:31129395 Mrpl18 Rat bisphenol A decreases expression ISO MRPL18 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MRPL18 mRNA CTD PMID:29275510 Mrpl18 Rat bisphenol F decreases expression ISO Mrpl18 (Mus musculus) 6480464 bisphenol F results in decreased expression of MRPL18 mRNA CTD PMID:38685157 Mrpl18 Rat cadmium atom multiple interactions ISO MRPL18 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MRPL18 mRNA CTD PMID:35301059 Mrpl18 Rat cadmium dichloride multiple interactions ISO MRPL18 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MRPL18 mRNA CTD PMID:35301059 Mrpl18 Rat celastrol increases expression ISO MRPL18 (Homo sapiens) 6480464 celastrol results in increased expression of MRPL18 mRNA CTD PMID:17010675 Mrpl18 Rat chloropicrin increases expression ISO MRPL18 (Homo sapiens) 6480464 chloropicrin results in increased expression of MRPL18 mRNA CTD PMID:26352163 Mrpl18 Rat cisplatin increases expression ISO MRPL18 (Homo sapiens) 6480464 Cisplatin results in increased expression of MRPL18 mRNA CTD PMID:27392435 Mrpl18 Rat copper atom multiple interactions ISO MRPL18 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of MRPL18 mRNA CTD PMID:24690739 Mrpl18 Rat copper(0) multiple interactions ISO MRPL18 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of MRPL18 mRNA CTD PMID:24690739 Mrpl18 Rat copper(II) sulfate increases expression ISO MRPL18 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MRPL18 mRNA CTD PMID:19549813 Mrpl18 Rat cyclosporin A increases expression ISO MRPL18 (Homo sapiens) 6480464 Cyclosporine results in increased expression of MRPL18 mRNA CTD PMID:20106945 Mrpl18 Rat Dibutyl phosphate affects expression ISO MRPL18 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MRPL18 mRNA CTD PMID:37042841 Mrpl18 Rat diethylstilbestrol increases expression ISO MRPL18 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of MRPL18 mRNA CTD PMID:36621641 Mrpl18 Rat disodium selenite increases expression ISO MRPL18 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of MRPL18 mRNA CTD PMID:18175754 Mrpl18 Rat disulfiram multiple interactions ISO MRPL18 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of MRPL18 mRNA CTD PMID:24690739 Mrpl18 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MRPL18 mRNA CTD PMID:24136188 Mrpl18 Rat folic acid multiple interactions ISO Mrpl18 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MRPL18 mRNA CTD PMID:22206623 Mrpl18 Rat gedunin increases expression ISO MRPL18 (Homo sapiens) 6480464 gedunin results in increased expression of MRPL18 mRNA CTD PMID:17010675 Mrpl18 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MRPL18 mRNA CTD PMID:22061828 Mrpl18 Rat hydrogen peroxide affects expression ISO MRPL18 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of MRPL18 mRNA CTD PMID:21179406 Mrpl18 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of MRPL18 mRNA CTD PMID:36868495 Mrpl18 Rat ivermectin decreases expression ISO MRPL18 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MRPL18 protein CTD PMID:32959892 Mrpl18 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of MRPL18 mRNA CTD PMID:20080153 Mrpl18 Rat ketoconazole increases expression ISO MRPL18 (Homo sapiens) 6480464 Ketoconazole results in increased expression of MRPL18 mRNA CTD PMID:36621641 Mrpl18 Rat Licochalcone B increases expression ISO MRPL18 (Homo sapiens) 6480464 licochalcone B results in increased expression of MRPL18 mRNA CTD PMID:33647349 Mrpl18 Rat lithium atom multiple interactions EXP 6480464 Lithium inhibits the reaction [Methamphetamine results in increased expression of MRPL18 mRNA] CTD PMID:19149911 Mrpl18 Rat lithium hydride multiple interactions EXP 6480464 Lithium inhibits the reaction [Methamphetamine results in increased expression of MRPL18 mRNA] CTD PMID:19149911 Mrpl18 Rat methamphetamine multiple interactions EXP 6480464 Lithium inhibits the reaction [Methamphetamine results in increased expression of MRPL18 mRNA] CTD PMID:19149911 Mrpl18 Rat methylisothiazolinone increases expression ISO MRPL18 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of MRPL18 mRNA CTD PMID:31629900 Mrpl18 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of MRPL18 mRNA CTD PMID:24136188 Mrpl18 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of MRPL18 mRNA CTD PMID:24136188 Mrpl18 Rat paracetamol affects expression ISO Mrpl18 (Mus musculus) 6480464 Acetaminophen affects the expression of MRPL18 mRNA CTD PMID:17562736 Mrpl18 Rat paracetamol decreases expression ISO MRPL18 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MRPL18 mRNA CTD PMID:31059760 Mrpl18 Rat paracetamol increases expression ISO MRPL18 (Homo sapiens) 6480464 Acetaminophen results in increased expression of MRPL18 mRNA CTD PMID:21420995 Mrpl18 Rat pirinixic acid decreases expression ISO Mrpl18 (Mus musculus) 6480464 pirinixic acid results in decreased expression of MRPL18 mRNA CTD PMID:18445702 Mrpl18 Rat silver atom increases expression ISO MRPL18 (Homo sapiens) 6480464 Silver results in increased expression of MRPL18 mRNA CTD PMID:26014281 Mrpl18 Rat silver(0) increases expression ISO MRPL18 (Homo sapiens) 6480464 Silver results in increased expression of MRPL18 mRNA CTD PMID:26014281 Mrpl18 Rat sodium arsenite increases expression ISO MRPL18 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MRPL18 mRNA CTD PMID:21457566 and PMID:34032870 Mrpl18 Rat sodium arsenite affects expression ISO MRPL18 (Homo sapiens) 6480464 sodium arsenite affects the expression of MRPL18 mRNA CTD PMID:29319823 Mrpl18 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of MRPL18 mRNA CTD PMID:19281266 Mrpl18 Rat streptozocin affects expression ISO Mrpl18 (Mus musculus) 6480464 Streptozocin affects the expression of MRPL18 mRNA CTD PMID:18583417 Mrpl18 Rat tetrachloromethane decreases expression ISO Mrpl18 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of MRPL18 mRNA CTD PMID:31919559 Mrpl18 Rat thapsigargin decreases expression ISO MRPL18 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of MRPL18 mRNA CTD PMID:22378314 Mrpl18 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MRPL18 mRNA CTD PMID:34492290 Mrpl18 Rat thiram increases expression ISO MRPL18 (Homo sapiens) 6480464 Thiram results in increased expression of MRPL18 mRNA CTD PMID:38568856 Mrpl18 Rat titanium dioxide decreases methylation ISO Mrpl18 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MRPL18 gene and titanium dioxide results in decreased methylation of MRPL18 promoter alternative form CTD PMID:35295148 Mrpl18 Rat tolcapone decreases expression EXP 6480464 tolcapone results in decreased expression of MRPL18 mRNA CTD PMID:24136188 Mrpl18 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of MRPL18 mRNA CTD PMID:31129395 Mrpl18 Rat trimellitic anhydride increases expression ISO Mrpl18 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of MRPL18 mRNA CTD PMID:19042947 Mrpl18 Rat tungsten increases expression ISO Mrpl18 (Mus musculus) 6480464 Tungsten results in increased expression of MRPL18 mRNA CTD PMID:30912803 Mrpl18 Rat valproic acid affects expression ISO Mrpl18 (Mus musculus) 6480464 Valproic Acid affects the expression of MRPL18 mRNA CTD PMID:17292431 Mrpl18 Rat zinc atom multiple interactions ISO MRPL18 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MRPL18 mRNA CTD PMID:18593933 Mrpl18 Rat zinc(0) multiple interactions ISO MRPL18 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MRPL18 mRNA CTD PMID:18593933
Mrpl18 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 50,384,951 - 50,389,769 (+) NCBI GRCr8 mRatBN7.2 1 47,837,169 - 47,841,987 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 47,836,561 - 47,841,987 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 48,528,807 - 48,533,628 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 54,514,771 - 54,519,522 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 48,604,336 - 48,609,149 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 48,033,531 - 48,038,726 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 48,033,768 - 48,038,726 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 51,713,672 - 51,718,630 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 42,111,647 - 42,116,465 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 42,114,536 - 42,119,412 (+) NCBI Celera 1 43,637,628 - 43,642,435 (+) NCBI Celera Cytogenetic Map 1 q11 NCBI
MRPL18 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 159,789,812 - 159,798,429 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 159,789,812 - 159,798,436 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 160,210,844 - 160,219,461 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 160,131,488 - 160,139,451 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 160,181,908 - 160,189,871 NCBI Celera 6 160,857,576 - 160,865,535 (+) NCBI Celera Cytogenetic Map 6 q25.3 NCBI HuRef 6 157,681,735 - 157,689,697 (+) NCBI HuRef CHM1_1 6 160,473,799 - 160,481,752 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 161,035,444 - 161,044,045 (+) NCBI T2T-CHM13v2.0
Mrpl18 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 13,130,232 - 13,136,674 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 13,130,236 - 13,135,232 (-) Ensembl GRCm39 Ensembl GRCm38 17 12,911,345 - 12,917,787 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 12,911,349 - 12,916,345 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 13,104,221 - 13,108,957 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 12,754,287 - 12,759,023 (-) NCBI MGSCv36 mm8 Celera 17 12,942,903 - 12,947,639 (-) NCBI Celera Cytogenetic Map 17 A1 NCBI cM Map 17 8.72 NCBI
Mrpl18 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955439 21,058,187 - 21,067,100 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955439 21,059,736 - 21,067,100 (-) NCBI ChiLan1.0 ChiLan1.0
MRPL18 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 179,888,896 - 179,896,827 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 177,793,850 - 177,801,782 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 157,673,328 - 157,681,324 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 162,684,950 - 162,693,002 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 162,684,958 - 162,693,002 (+) Ensembl panpan1.1 panPan2
MRPL18 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 49,038,814 - 49,043,667 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 49,038,871 - 49,043,501 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 49,880,740 - 49,885,636 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 49,223,445 - 49,228,365 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 49,223,559 - 49,228,207 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 49,105,805 - 49,110,739 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 48,976,978 - 48,981,811 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 49,592,154 - 49,597,020 (+) NCBI UU_Cfam_GSD_1.0
Mrpl18 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 144,031,650 - 144,037,129 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936489 11,283,309 - 11,289,200 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936489 11,283,601 - 11,289,125 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MRPL18 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 7,581,764 - 7,590,031 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 7,581,763 - 7,590,037 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 9,380,719 - 9,389,025 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MRPL18 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 87,389,210 - 87,395,134 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 87,389,702 - 87,394,866 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 59,787,984 - 59,793,951 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mrpl18
.
Predicted Target Of
Count of predictions: 245 Count of miRNA genes: 179 Interacting mature miRNAs: 204 Transcripts: ENSRNOT00000020064 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331732 Srn4 Serum renin concentration QTL 4 4.467 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 1 35239598 78430678 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1357397 Bw41 Body weight QTL 41 4.19 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 1331792 Rf29 Renal function QTL 29 4.589 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 1 35239598 78430678 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 1354643 Foco2 Food consumption QTL 2 7.17 0.0001 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 1 33449848 78449848 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 7421626 Bp360 Blood pressure QTL 360 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 4393289 49393289 Rat 1357400 Bw62 Body weight QTL62 4.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 1 22340647 67340647 Rat 1357401 Bw43 Body weight QTL 43 3.75 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 631494 Bp95 Blood pressure QTL 95 40 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 16206210 49268520 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 5684998 Bss101 Bone structure and strength QTL 101 3.6 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 1 15431621 49361612 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 5684999 Bss102 Bone structure and strength QTL 102 5.5 7e-07 tibia strength trait (VT:1000284) tibia stiffness (CMO:0001735) 1 15431621 49361612 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 1300167 Hrtrt2 Heart rate QTL 2 4.35 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 11481312 75088344 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1331778 Rf28 Renal function QTL 28 4.66 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 1 45803140 78430678 Rat 1578756 Iddm22 Insulin dependent diabetes mellitus QTL 22 2.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 11835181 56835181 Rat 631508 Sald1 Serum aldosterone level QTL 1 3.7 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 1 9856001 54856001 Rat 1331785 Rf27 Renal function QTL 27 4.643 urine sodium amount (VT:0006274) urine sodium level (CMO:0000129) 1 28879780 78430678 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 724520 Bp145 Blood pressure QTL 145 2.1 0.0024 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 20784828 65784828 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 738020 Pia8 Pristane induced arthritis QTL 8 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 1 65833076 Rat 1354599 Bw29 Body weight QTL 29 3.46 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 33449848 78449848 Rat 2302038 Pia31 Pristane induced arthritis QTL 31 5.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 1 10992065 55992065 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 634353 Rends2 Renal damage susceptibility QTL 2 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 1 19333571 56983283 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020064 ⟹ ENSRNOP00000020064
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,836,893 - 47,841,982 (+) Ensembl Rnor_6.0 Ensembl 1 48,033,768 - 48,038,726 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095564 ⟹ ENSRNOP00000097569
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,837,038 - 47,841,987 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000101637 ⟹ ENSRNOP00000076617
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,836,561 - 47,841,987 (+) Ensembl
RefSeq Acc Id:
NM_001106205 ⟹ NP_001099675
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,384,952 - 50,389,769 (+) NCBI mRatBN7.2 1 47,837,169 - 47,841,987 (+) NCBI Rnor_6.0 1 48,033,768 - 48,038,726 (+) NCBI Rnor_5.0 1 51,713,672 - 51,718,630 (-) NCBI RGSC_v3.4 1 42,111,647 - 42,116,465 (+) RGD Celera 1 43,637,628 - 43,642,435 (+) RGD
Sequence:
GTTAACATGGCTGCGACTAGTTATTCACCGAGACGACCGTGAGCAGAGGAAGGCAGGGCACTGTGAGACTTTGCCCACTTCCGGTCAGCGATGGCGCTTCAGCCGCGGTTCTGGAAATGTCTGTCAGT
hide sequence
RefSeq Acc Id:
XM_063282850 ⟹ XP_063138920
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,384,951 - 50,389,769 (+) NCBI
RefSeq Acc Id:
NP_001099675 ⟸ NM_001106205
- UniProtKB:
B2RZ57 (UniProtKB/TrEMBL), A6KJV6 (UniProtKB/TrEMBL), A0A8I5Y0J7 (UniProtKB/TrEMBL), F7FA85 (UniProtKB/TrEMBL)
- Sequence:
MALQPRFWKCLSVCRNLECGFASLSTSSTPAVQPDVETKENEAVAPEFINRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVSASTREWAIKKHLYSTRNVVACESV
hide sequence
Ensembl Acc Id:
ENSRNOP00000020064 ⟸ ENSRNOT00000020064
Ensembl Acc Id:
ENSRNOP00000076617 ⟸ ENSRNOT00000101637
Ensembl Acc Id:
ENSRNOP00000097569 ⟸ ENSRNOT00000095564
RefSeq Acc Id:
XP_063138920 ⟸ XM_063282850
- Peptide Label:
isoform X1
RGD ID: 13689616 Promoter ID: EPDNEW_R140 Type: initiation region Name: Mrpl18_1 Description: mitochondrial ribosomal protein L18 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 48,033,753 - 48,033,813 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Mrpl18
mitochondrial ribosomal protein L18
Mrpl18_predicted
mitochondrial ribosomal protein L18 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Mrpl18_predicted
mitochondrial ribosomal protein L18 (predicted)
Symbol and Name status set to approved
70820 APPROVED
