Henmt1 (HEN methyltransferase 1) - Rat Genome Database

Name: Henmt1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Henmt1 (HEN methyltransferase 1) Rattus norvegicus

Analyze

Symbol:

Henmt1

Name:

HEN methyltransferase 1

RGD ID:

1306230

Description:

Predicted to enable small RNA 2'-O-methyltransferase activity. Predicted to be involved in RNA methylation; piRNA processing; and siRNA processing. Predicted to be located in P granule. Predicted to be active in cytoplasm and nucleus. Orthologous to human HENMT1 (HEN methyltransferase 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

HEN1 methyltransferase homolog 1; HEN1 methyltransferase homolog 1 (Arabidopsis); hypothetical protein LOC100363095; hypothetical protein LOC365902; LOC100363095; LOC365902; MGC125117; RGD1306230; similar to hypothetical protein FLJ30525; small RNA 2'-O-methyltransferase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HENMT1 (HEN methyltransferase 1)	HGNC	Ensembl, HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Henmt1 (HEN1 methyltransferase homolog 1 (Arabidopsis))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Henmt1 (HEN methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HENMT1 (HEN methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HENMT1 (HEN methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Henmt1 (HEN methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HENMT1 (HEN methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HENMT1 (HEN methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Henmt1 (HEN methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Henmt1 (HEN1 methyltransferase homolog 1 (Arabidopsis))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HENMT1 (HEN methyltransferase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	henmt1 (HEN methyltransferase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	henn-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Hen1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	henmt1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	199,258,107 - 199,291,739 (+)	NCBI		GRCr8
mRatBN7.2	2	196,585,732 - 196,603,700 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	196,586,797 - 196,599,738 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	204,230,540 - 204,242,798 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	202,118,362 - 202,130,609 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	196,935,420 - 196,947,668 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	211,740,571 - 211,753,718 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	2	231,214,546 - 231,225,175 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	204,544,606 - 204,558,076 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	204,506,770 - 204,520,830 (+)	NCBI
Celera	2	189,235,772 - 189,247,793 (+)	NCBI		Celera
Cytogenetic Map	2	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

azoospermia (ISO)

hereditary spastic paraplegia 63 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

avobenzone (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

butanal (ISO)

cisplatin (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

diquat (ISO)

dorsomorphin (ISO)

entinostat (ISO)

furan (EXP)

genistein (ISO)

hydralazine (ISO)

indometacin (ISO)

methylmercury chloride (ISO)

SB 431542 (ISO)

sunitinib (ISO)

thimerosal (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

piRNA processing (IBA,ISO,ISS)

regulatory ncRNA-mediated gene silencing (IEA)

RNA methylation (IEA,ISO,ISS)

siRNA processing (IBA)

Cellular Component

cytoplasm (IBA)

nucleus (IBA)

P granule (ISS)

Molecular Function

metal ion binding (IEA)

O-methyltransferase activity (IBA,IEA,ISO,ISS)

protein binding (ISO)

RNA binding (IEA)

RNA methyltransferase activity (IBA,IEA,ISO,ISS)

small RNA 2'-O-methyltransferase activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:15632090	PMID:17652135	PMID:18029764

Genomics

Comparative Map Data

Henmt1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	199,258,107 - 199,291,739 (+)	NCBI		GRCr8
mRatBN7.2	2	196,585,732 - 196,603,700 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	196,586,797 - 196,599,738 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	204,230,540 - 204,242,798 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	202,118,362 - 202,130,609 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	196,935,420 - 196,947,668 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	211,740,571 - 211,753,718 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	2	231,214,546 - 231,225,175 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	204,544,606 - 204,558,076 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	204,506,770 - 204,520,830 (+)	NCBI
Celera	2	189,235,772 - 189,247,793 (+)	NCBI		Celera
Cytogenetic Map	2	q41	NCBI

HENMT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	108,648,295 - 108,661,474 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	108,648,290 - 108,661,526 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	109,190,917 - 109,204,096 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	108,992,433 - 109,005,671 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	107,460,828 - 107,474,037 (-)	NCBI		Celera
Cytogenetic Map	1	p13.3	NCBI
HuRef	1	107,083,630 - 107,096,727 (-)	NCBI		HuRef
CHM1_1	1	109,305,731 - 109,318,961 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	108,681,289 - 108,694,467 (-)	NCBI		T2T-CHM13v2.0

Henmt1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	108,846,770 - 108,887,201 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	108,847,375 - 108,868,090 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	108,939,454 - 108,979,885 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	108,940,059 - 108,960,774 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	108,743,002 - 108,763,694 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	109,068,140 - 109,088,732 (+)	NCBI		MGSCv36	mm8
Celera	3	111,275,307 - 111,295,934 (+)	NCBI		Celera
Cytogenetic Map	3	F3	NCBI
cM Map	3	47.99	NCBI

Henmt1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955435	12,138,177 - 12,154,630 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955435	12,137,537 - 12,154,630 (-)	NCBI	ChiLan1.0	ChiLan1.0

HENMT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	118,641,837 - 118,657,252 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	117,801,704 - 117,817,082 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	111,023,949 - 111,037,138 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	110,191,227 - 110,204,275 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	110,191,227 - 110,204,270 (-)	Ensembl	panpan1.1		panPan2

HENMT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	6	45,928,483 - 45,943,590 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	43,396,229 - 43,435,695 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	43,428,453 - 43,435,709 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	43,152,578 - 43,167,498 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	43,084,944 - 43,088,221 (+)	NCBI		UNSW_CanFamBas_1.0
UNSW_CanFamBas_1.0	6	43,125,908 - 43,140,909 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	43,552,275 - 43,567,220 (+)	NCBI		UU_Cfam_GSD_1.0

Henmt1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	19,857,460 - 19,870,919 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936704	242,262 - 256,739 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HENMT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	111,364,966 - 111,382,572 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	111,364,456 - 111,382,582 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	121,863,155 - 121,881,143 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HENMT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	24,920,224 - 24,936,429 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	24,921,611 - 24,936,419 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	33,410,548 - 33,426,967 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Henmt1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	4,456,917 - 4,470,558 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624772	4,452,320 - 4,470,097 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Henmt1
165 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	392
Count of miRNA genes:	226
Interacting mature miRNAs:	258
Transcripts:	ENSRNOT00000066924
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	184114274	202447032	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	185876309	219753474	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	189599258	218414891	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001037655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101545	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC129843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC107926	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000066924 ⟹ ENSRNOP00000060946

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	196,586,797 - 196,599,658 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000115077 ⟹ ENSRNOP00000095551

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	196,587,615 - 196,599,738 (+)	Ensembl

RefSeq Acc Id:

NM_001037655 ⟹ NP_001032744

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	199,275,638 - 199,287,824 (+)	NCBI
mRatBN7.2	2	196,587,549 - 196,599,740 (+)	NCBI
Rnor_6.0	2	211,740,571 - 211,753,718 (+)	NCBI
Rnor_5.0	2	231,214,546 - 231,225,175 (+)	NCBI
Celera	2	189,235,772 - 189,247,793 (+)	RGD

Sequence:

show sequence

CTGATACAGAGCCCAGAGGATAAATCTGGATTTTTACTTTTTGTCACAATGGAAGTCGAAAACC
AAATGGAAACGGCAGAAAACATACCGTGCAGTATGCTTGGTGATAATTTCAAAGAAGTTTGTGC
AGAGAAGGTAATTAGGTTCAGGCCGCCATTATACAAACAACGGTACCAGTTCGTTAGAGATTTA
GTGGATCGCCATGAACCCAAGAAGGTTGCAGACCTGGGATGTGGTGATACCAAGCTCCTAAAGC
TGCTAAAAATCTACCCATGCATTCAGCTGCTTGTTGGGGTGGATATCAATGAGGAAAAATTGCA
TTCAAATGGGCATCGCTTGTCTCCCTATTTGGGGGAGTTCGTAAAACCCCGAGATCTAGATTTG
ACTGTCACCTTGTATCATGGCTCTGTTGTGGAGAGAGACTCGCGCTTGCTTGGATTCGATTTGA
TAACATGCATTGAATTAATAGAACATCTGGATTCAGATGATCTGGCCAGATTTCCTGAAGTGGT
TTTTGGATACCTGTCACCAGCCATGGTTGTCATCAGCACACCAAATGCTGAGTTCAACCCCCTG
TTTCCTACAGTGACCCTGAGGGACGCCGATCATAAGTTTGAGTGGAGCAGAATGGAGTTTCAGA
CCTGGGCTTCACAGGTGGCAAACTGCTACAATTACTGTGTGGAGTTCACTGGGGTGGGGACACC
CCCAGCTGGATCTGAGCATGTTGGATATTGCACCCAGATAGGTGTCTTTAGGAAAAACGGTGGG
AAGCTCTCTGAGCCCTCTGCTTCCCAGCAGCGTGACCAGCATGTTTATAAAGCTGTTTATACAA
CCTCCTACCCGAGTTTACAGCAGGAGAAGGTGCTCAAGTTTGTACTGGTTGGGGAACTCCTGAT
ACAAGTGGACCGCCTGAGGCTGAGACACCAGAGAATGCTGCGGGAACAGGAGAAGGAGCGGGGC
CCTAAGCCCTGGTACACGGACTCCTCCCCAGCCCCCCACCTACTGTTGGGAGCAGTCTTCACAG
AGGCCGAGAAGGCCAGGATAGAAAATTCTCCCAAACCCTTCTGTGAAGGAGAGAAGTTTTACAT
ACCCCTGCAGAGACTGCTCACTTACCCCAAACTGCACCGGCTGTGTGCTGACGAAGACAGGATG
CGGTCCCTCATCGCTGACTCGGTGTGCTTAAGCAGTGATGGTTCCGCAGTCGTGGTTGACCTCC
ATAATTCTTGGGATTATCGGCCTGAGGATAACTGAGCCATCCGGATTTCCTGAAGCTCGGACAC
TGGCTGATAGTTGGGTTCGTTTAGAATTCGCACTTTTTTTGTTTTAGTGGTGCTGGGACTCAAA
CCCTTGCTCATGGTAAGCAAGCACTCTGCCTCTCGGCTACATCCTCAGCCCCAGAATTTAAGCT
TTGTACAGTCATCATTCAAGAAGTGTTTCGAGAGTTACACAGATCGGGTCCTGATCTGGATGGC
AGCTCTGCCTGACACACAGACTGCTCTTGGGCTTAACCAAACCAAGTTGCTTTCCTTTAAAATT
AGATTTTTTTTTAAAAATTTTTTTGGTGTTTACAACAATATAGAAATTGGATGTGGTAATGTGT
TAATTTTGTCCTCACCCATATTTTGGTGTTAGAGCCGTATGTTGTATGTGACATTAAAACATTT
AAATGTAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039101543 ⟹ XP_038957471

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	199,258,107 - 199,287,824 (+)	NCBI
mRatBN7.2	2	196,585,733 - 196,603,700 (+)	NCBI

RefSeq Acc Id:

XM_039101544 ⟹ XP_038957472

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	199,274,811 - 199,287,824 (+)	NCBI
mRatBN7.2	2	196,586,722 - 196,603,700 (+)	NCBI

RefSeq Acc Id:

XM_039101545 ⟹ XP_038957473

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	199,258,107 - 199,291,739 (+)	NCBI
mRatBN7.2	2	196,585,732 - 196,603,700 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001032744	(Get FASTA)	NCBI Sequence Viewer
	XP_038957471	(Get FASTA)	NCBI Sequence Viewer
	XP_038957472	(Get FASTA)	NCBI Sequence Viewer
	XP_038957473	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI07927	(Get FASTA)	NCBI Sequence Viewer
	EDL81971	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060946
	ENSRNOP00000060946.4
	ENSRNOP00000095551
	ENSRNOP00000095551.1
GenBank Protein	Q32PY6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001032744 ⟸ NM_001037655

- UniProtKB:

Q32PY6 (UniProtKB/Swiss-Prot), A6HV35 (UniProtKB/TrEMBL), F1LQ15 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEVENQMETAENIPCSMLGDNFKEVCAEKVIRFRPPLYKQRYQFVRDLVDRHEPKKVADLGCGD
TKLLKLLKIYPCIQLLVGVDINEEKLHSNGHRLSPYLGEFVKPRDLDLTVTLYHGSVVERDSRL
LGFDLITCIELIEHLDSDDLARFPEVVFGYLSPAMVVISTPNAEFNPLFPTVTLRDADHKFEWS
RMEFQTWASQVANCYNYCVEFTGVGTPPAGSEHVGYCTQIGVFRKNGGKLSEPSASQQRDQHVY
KAVYTTSYPSLQQEKVLKFVLVGELLIQVDRLRLRHQRMLREQEKERGPKPWYTDSSPAPHLLL
GAVFTEAEKARIENSPKPFCEGEKFYIPLQRLLTYPKLHRLCADEDRMRSLIADSVCLSSDGSA
VVVDLHNSWDYRPEDN

hide sequence

RefSeq Acc Id:	XP_038957473 ⟸ XM_039101545
- Peptide Label:	isoform X1
- UniProtKB:	Q32PY6 (UniProtKB/Swiss-Prot), A6HV35 (UniProtKB/TrEMBL), F1LQ15 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038957471 ⟸ XM_039101543
- Peptide Label:	isoform X1
- UniProtKB:	Q32PY6 (UniProtKB/Swiss-Prot), A6HV35 (UniProtKB/TrEMBL), F1LQ15 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038957472 ⟸ XM_039101544
- Peptide Label:	isoform X1
- UniProtKB:	Q32PY6 (UniProtKB/Swiss-Prot), A6HV35 (UniProtKB/TrEMBL), F1LQ15 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000095551 ⟸ ENSRNOT00000115077

RefSeq Acc Id:

ENSRNOP00000060946 ⟸ ENSRNOT00000066924

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q32PY6-F1-model_v2	AlphaFold	Q32PY6	1-394	view protein structure
AF-F1LQ15-F1-model_v2	AlphaFold	F1LQ15	1-403	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306230	AgrOrtholog
BioCyc Gene	G2FUF-51585	BioCyc
Ensembl Genes	ENSRNOG00000042814	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000066924.4	UniProtKB/TrEMBL
	ENSRNOT00000115077	ENTREZGENE
	ENSRNOT00000115077.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.150	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7132526	IMAGE-MGC_LOAD
InterPro	Hen1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SAM-dependent_MTases	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:100363095	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:125117	IMAGE-MGC_LOAD
NCBI Gene	Henmt1	ENTREZGENE
PANTHER	PTHR21404	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SMALL RNA 2'-O-METHYLTRANSFERASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Methyltransf_23	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Henmt1	PhenoGen
RatGTEx	ENSRNOG00000042814	RatGTEx
Superfamily-SCOP	SSF53335	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6GL71_RAT	UniProtKB/TrEMBL
	A6HV35	ENTREZGENE, UniProtKB/TrEMBL
	F1LQ15	ENTREZGENE, UniProtKB/TrEMBL
	HENMT_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-05-24	Henmt1	HEN methyltransferase 1	Henmt1	HEN1 methyltransferase homolog 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-29	Henmt1	HEN1 methyltransferase homolog 1	Henmt1	HEN1 methyltransferase homolog 1 (Arabidopsis)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-10-17	Henmt1	HEN1 methyltransferase homolog 1 (Arabidopsis)	LOC100363095	hypothetical protein LOC100363095	Data merged from RGD:2324794	737654	APPROVED
2011-05-26	Henmt1	HEN1 methyltransferase homolog 1 (Arabidopsis)	RGD1306230	similar to hypothetical protein FLJ30525	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-05-12	LOC100363095	hypothetical protein LOC100363095			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-07	RGD1306230	similar to hypothetical protein FLJ30525	RGD1306230_predicted	similar to hypothetical protein FLJ30525 (predicted)	Symbol and Name status set to approved	1299863	APPROVED
2005-01-20	RGD1306230_predicted	similar to hypothetical protein FLJ30525 (predicted)	LOC365902_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC365902_predicted	similar to hypothetical protein FLJ30525 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar