Symbol:
Ash2l
Name:
ASH2 like histone lysine methyltransferase complex subunit
RGD ID:
1305632
Description:
Predicted to enable beta-catenin binding activity and transcription cis-regulatory region binding activity. Predicted to be involved in positive regulation of cell population proliferation; response to estrogen; and transcription initiation-coupled chromatin remodeling. Predicted to act upstream of or within DNA damage response and positive regulation of transcription by RNA polymerase II. Predicted to be located in euchromatin and nucleus. Predicted to be part of MLL1 complex; MLL3/4 complex; and Set1C/COMPASS complex. Biomarker of schizophrenia. Orthologous to human ASH2L (ASH2 like, histone lysine methyltransferase complex subunit); PARTICIPATES IN histone modification pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ash2 (absent, small, or homeotic)-like; ash2 (absent, small, or homeotic)-like (Drosophila); LOC290829; set1/Ash2 histone methyltransferase complex subunit ASH2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ASH2L (ASH2 like, histone lysine methyltransferase complex subunit) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Ash2l (ASH2 like histone lysine methyltransferase complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ash2l (ASH2 like, histone lysine methyltransferase complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ASH2L (ASH2 like, histone lysine methyltransferase complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ASH2L (ASH2 like, histone lysine methyltransferase complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ash2l (ASH2 like, histone lysine methyltransferase complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ASH2L (ASH2 like, histone lysine methyltransferase complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ASH2L (ASH2 like, histone lysine methyltransferase complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ash2l (ASH2 like, histone lysine methyltransferase complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ASH2L (ASH2 like, histone lysine methyltransferase complex subunit)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ash2l (ASH2 like histone lysine methyltransferase complex subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ash2l (ash2 like, histone lysine methyltransferase complex subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
BRE2
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
ash-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
ash2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ash2l
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 72,943,527 - 72,966,791 (+) NCBI GRCr8 mRatBN7.2 16 66,242,205 - 66,264,064 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 66,242,212 - 66,264,061 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 71,520,834 - 71,542,299 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 74,927,142 - 74,948,609 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 70,167,036 - 70,188,505 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 71,011,315 - 71,033,171 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 71,011,332 - 71,032,790 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 70,675,994 - 70,697,849 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 70,617,717 - 70,639,166 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 70,604,210 - 70,639,337 (+) NCBI Celera 16 64,152,097 - 64,173,546 (+) NCBI Celera Cytogenetic Map 16 q12.4 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ash2l Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ASH2L (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ASH2L mRNA CTD PMID:22079256 Ash2l Rat 1,2-dimethylhydrazine increases expression ISO Ash2l (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ASH2L mRNA CTD PMID:22206623 Ash2l Rat 17alpha-ethynylestradiol multiple interactions ISO Ash2l (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ASH2L mRNA CTD PMID:17942748 Ash2l Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO ASH2L (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ash2l Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ash2l (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ASH2L mRNA CTD PMID:17942748 Ash2l Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ASH2L mRNA CTD PMID:33387578 Ash2l Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ash2l (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ASH2L mRNA CTD PMID:21570461 Ash2l Rat 2,4,6-tribromophenol decreases expression ISO ASH2L (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ash2l Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ASH2L mRNA CTD PMID:21346803 Ash2l Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ASH2L mRNA CTD PMID:21346803 Ash2l Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO ASH2L (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of ASH2L protein CTD PMID:31675489 Ash2l Rat 4,4'-sulfonyldiphenol increases expression ISO Ash2l (Mus musculus) 6480464 bisphenol S results in increased expression of ASH2L mRNA CTD PMID:39298647 Ash2l Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of ASH2L mRNA CTD PMID:21346803 Ash2l Rat arsane multiple interactions ISO ASH2L (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ASH2L mRNA CTD PMID:39836092 Ash2l Rat arsenic atom multiple interactions ISO ASH2L (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ASH2L mRNA CTD PMID:39836092 Ash2l Rat benzo[a]pyrene affects methylation ISO ASH2L (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ASH2L intron CTD PMID:30157460 Ash2l Rat benzophenanthridine decreases expression ISO ASH2L (Homo sapiens) 6480464 Benzophenanthridines analog results in decreased expression of ASH2L mRNA CTD PMID:23117580 Ash2l Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ASH2L mRNA CTD PMID:25181051 Ash2l Rat bisphenol A decreases expression ISO ASH2L (Homo sapiens) 6480464 bisphenol A results in decreased expression of ASH2L protein CTD PMID:31675489 Ash2l Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ASH2L mRNA CTD PMID:30816183 more ... Ash2l Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of ASH2L gene CTD PMID:28505145 Ash2l Rat bisphenol A affects methylation ISO Ash2l (Mus musculus) 6480464 bisphenol A affects the methylation of ASH2L promoter CTD PMID:27334623 Ash2l Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ASH2L gene CTD PMID:28505145 Ash2l Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of ASH2L promoter CTD PMID:22457795 Ash2l Rat carbamazepine affects expression ISO ASH2L (Homo sapiens) 6480464 Carbamazepine affects the expression of ASH2L mRNA CTD PMID:24752500 Ash2l Rat chlorpyrifos decreases expression ISO Ash2l (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of ASH2L mRNA CTD PMID:37019170 Ash2l Rat choline multiple interactions ISO Ash2l (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ASH2L gene CTD PMID:20938992 Ash2l Rat cisplatin increases expression ISO ASH2L (Homo sapiens) 6480464 Cisplatin results in increased expression of ASH2L mRNA CTD PMID:27594783 Ash2l Rat copper(II) sulfate decreases expression ISO ASH2L (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ASH2L mRNA CTD PMID:19549813 Ash2l Rat cyclosporin A decreases expression ISO ASH2L (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ASH2L mRNA CTD PMID:25562108 Ash2l Rat decabromodiphenyl ether decreases expression ISO ASH2L (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of ASH2L protein CTD PMID:31675489 Ash2l Rat desferrioxamine B increases expression ISO ASH2L (Homo sapiens) 6480464 Deferoxamine results in increased expression of ASH2L mRNA CTD PMID:23483119 Ash2l Rat desferrioxamine B affects expression ISO ASH2L (Homo sapiens) 6480464 Deferoxamine affects the expression of ASH2L mRNA CTD PMID:23483119 Ash2l Rat Dibutyl phosphate affects expression ISO ASH2L (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ASH2L mRNA CTD PMID:37042841 Ash2l Rat diclofenac affects expression ISO ASH2L (Homo sapiens) 6480464 Diclofenac affects the expression of ASH2L mRNA CTD PMID:24752500 Ash2l Rat diuron increases expression EXP 6480464 Diuron results in increased expression of ASH2L mRNA CTD PMID:21551480 Ash2l Rat doxorubicin decreases expression ISO ASH2L (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ASH2L mRNA CTD PMID:29803840 Ash2l Rat enzyme inhibitor multiple interactions ISO ASH2L (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of ASH2L protein CTD PMID:23301498 Ash2l Rat ethanol increases expression ISO ASH2L (Homo sapiens) 6480464 Ethanol results in increased expression of ASH2L mRNA and Ethanol results in increased expression of ASH2L protein CTD PMID:28986285 and PMID:35149083 Ash2l Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of ASH2L mRNA CTD PMID:24136188 Ash2l Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ASH2L mRNA CTD PMID:24136188 Ash2l Rat folic acid multiple interactions ISO Ash2l (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ASH2L gene CTD PMID:20938992 Ash2l Rat folic acid decreases expression ISO ASH2L (Homo sapiens) 6480464 Folic Acid results in decreased expression of ASH2L mRNA CTD PMID:21867686 Ash2l Rat FR900359 increases phosphorylation ISO ASH2L (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ASH2L protein CTD PMID:37730182 Ash2l Rat genistein multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of ASH2L gene CTD PMID:28505145 Ash2l Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ASH2L mRNA CTD PMID:22061828 Ash2l Rat inulin multiple interactions ISO Ash2l (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ASH2L mRNA CTD PMID:36331819 Ash2l Rat L-methionine multiple interactions ISO Ash2l (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ASH2L gene CTD PMID:20938992 Ash2l Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of ASH2L mRNA CTD PMID:30467583 Ash2l Rat methyl methanesulfonate increases expression ISO ASH2L (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of ASH2L mRNA CTD PMID:23649840 Ash2l Rat methylazoxymethanol decreases expression EXP 6480464 methylazoxymethanol results in decreased expression of ASH2L protein CTD PMID:23932495 Ash2l Rat methylmercury chloride decreases expression ISO ASH2L (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of ASH2L mRNA CTD PMID:28001369 Ash2l Rat paracetamol affects expression ISO Ash2l (Mus musculus) 6480464 Acetaminophen affects the expression of ASH2L mRNA CTD PMID:17562736 Ash2l Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ASH2L mRNA CTD PMID:33387578 Ash2l Rat perfluorooctane-1-sulfonic acid increases expression ISO Ash2l (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of ASH2L protein CTD PMID:26178269 Ash2l Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ash2l (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ASH2L mRNA CTD PMID:36331819 Ash2l Rat potassium chromate multiple interactions ISO ASH2L (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ASH2L mRNA CTD PMID:22079256 Ash2l Rat potassium chromate decreases expression ISO ASH2L (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ASH2L mRNA CTD PMID:22079256 Ash2l Rat sodium arsenite decreases expression ISO ASH2L (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ASH2L mRNA CTD PMID:38568856 Ash2l Rat sodium arsenite multiple interactions ISO ASH2L (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ASH2L mRNA CTD PMID:39836092 Ash2l Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ASH2L mRNA CTD PMID:23411599 Ash2l Rat titanium dioxide increases expression ISO Ash2l (Mus musculus) 6480464 titanium dioxide results in increased expression of ASH2L mRNA CTD PMID:23557971 Ash2l Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of ASH2L gene CTD PMID:27618143 Ash2l Rat trimellitic anhydride increases expression ISO Ash2l (Mus musculus) 6480464 trimellitic anhydride results in increased expression of ASH2L mRNA CTD PMID:19042947 Ash2l Rat triptonide affects expression ISO Ash2l (Mus musculus) 6480464 triptonide affects the expression of ASH2L mRNA CTD PMID:33045310 Ash2l Rat valproic acid affects expression ISO ASH2L (Homo sapiens) 6480464 Valproic Acid affects the expression of ASH2L mRNA CTD PMID:25979313
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzophenanthridine (ISO) bisphenol A (EXP,ISO) cadmium dichloride (EXP) carbamazepine (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) desferrioxamine B (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) diuron (EXP) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) genistein (EXP) gentamycin (EXP) inulin (ISO) L-methionine (ISO) methapyrilene (EXP) methyl methanesulfonate (ISO) methylazoxymethanol (EXP) methylmercury chloride (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) potassium chromate (ISO) sodium arsenite (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) triptonide (ISO) valproic acid (ISO)
Ash2l Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 72,943,527 - 72,966,791 (+) NCBI GRCr8 mRatBN7.2 16 66,242,205 - 66,264,064 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 66,242,212 - 66,264,061 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 71,520,834 - 71,542,299 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 74,927,142 - 74,948,609 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 70,167,036 - 70,188,505 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 71,011,315 - 71,033,171 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 71,011,332 - 71,032,790 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 70,675,994 - 70,697,849 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 70,617,717 - 70,639,166 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 70,604,210 - 70,639,337 (+) NCBI Celera 16 64,152,097 - 64,173,546 (+) NCBI Celera Cytogenetic Map 16 q12.4 NCBI
ASH2L Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 38,105,493 - 38,140,080 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 38,105,493 - 38,144,076 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 37,963,011 - 37,997,598 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 38,082,168 - 38,116,385 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 38,082,222 - 38,116,215 NCBI Celera 8 36,915,527 - 36,949,763 (+) NCBI Celera Cytogenetic Map 8 p11.23 NCBI HuRef 8 36,498,048 - 36,532,653 (+) NCBI HuRef CHM1_1 8 38,164,558 - 38,199,166 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 38,382,461 - 38,417,070 (+) NCBI T2T-CHM13v2.0
Ash2l Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 26,306,028 - 26,337,722 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 26,306,024 - 26,337,722 (-) Ensembl GRCm39 Ensembl GRCm38 8 25,816,000 - 25,847,694 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 25,815,996 - 25,847,694 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 26,927,342 - 26,958,142 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 27,282,420 - 27,306,314 (-) NCBI MGSCv36 mm8 Celera 8 27,285,099 - 27,316,003 (-) NCBI Celera Cytogenetic Map 8 A2 NCBI cM Map 8 14.17 NCBI
Ash2l Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955463 13,731,506 - 13,761,684 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955463 13,731,651 - 13,757,475 (+) NCBI ChiLan1.0 ChiLan1.0
ASH2L Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 56,668,224 - 56,703,010 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 32,385,206 - 32,419,992 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 37,408,151 - 37,442,080 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 34,583,265 - 34,618,183 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 34,583,265 - 34,618,183 (+) Ensembl panpan1.1 panPan2
ASH2L Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 27,334,419 - 27,366,994 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 27,334,420 - 27,366,950 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 27,851,728 - 27,884,205 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 29,233,604 - 29,265,821 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 29,233,605 - 29,265,789 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 27,455,901 - 27,488,143 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 28,033,174 - 28,065,614 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 28,072,602 - 28,104,856 (-) NCBI UU_Cfam_GSD_1.0
Ash2l Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 49,941,735 - 49,971,854 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936710 1,489,522 - 1,518,849 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936710 1,489,483 - 1,519,469 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ASH2L Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 48,386,425 - 48,417,547 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 48,386,426 - 48,417,560 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 55,511,516 - 55,552,522 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ASH2L
Ash2l
.
Predicted Target Of
Count of predictions: 420 Count of miRNA genes: 227 Interacting mature miRNAs: 272 Transcripts: ENSRNOT00000020181 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
2300163 Bmd64 Bone mineral density QTL 64 5.3 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 16 37752156 82752156 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 1578768 Stresp22 Stress response QTL 22 2.8 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 16 35288870 80288870 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 7205510 Activ5 Activity QTL 5 3.78 0.00028 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 42396345 84729064 Rat 631525 Pia14 Pristane induced arthritis QTL 14 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 16 55711087 83402471 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 7411648 Foco22 Food consumption QTL 22 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 52726464 84729064 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 2293690 Bss45 Bone structure and strength QTL 45 5.13 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 16 37752156 82752156 Rat 8694364 Abfw7 Abdominal fat weight QTL 7 12.22 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 16 52726464 84729064 Rat 8694429 Bw164 Body weight QTL 164 5 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 16 52726464 84729064 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat
RH140073
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 16 621.91 UniSTS Cytogenetic Map 16 q12.4 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020181 ⟹ ENSRNOP00000020181
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 66,242,212 - 66,264,061 (+) Ensembl Rnor_6.0 Ensembl 16 71,011,341 - 71,032,790 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000086891 ⟹ ENSRNOP00000068617
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 66,242,212 - 66,264,061 (+) Ensembl Rnor_6.0 Ensembl 16 71,011,332 - 71,032,474 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100676 ⟹ ENSRNOP00000094978
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 66,242,494 - 66,264,061 (+) Ensembl
RefSeq Acc Id:
NM_001106089 ⟹ NP_001099559
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 72,944,961 - 72,966,410 (+) NCBI mRatBN7.2 16 66,242,230 - 66,263,680 (+) NCBI Rnor_6.0 16 71,011,341 - 71,032,790 (+) NCBI Rnor_5.0 16 70,675,994 - 70,697,849 (+) NCBI RGSC_v3.4 16 70,617,717 - 70,639,166 (+) RGD Celera 16 64,152,097 - 64,173,546 (+) RGD
Sequence:
GAAGTAGCAGCAATGGCGGCGACTGGAGTGGGTCCTGGCCCTGGAGTGGGCGCCGGCTCTGGTCCAGGAGCAGCTGCAAGTGCCACAACGACAGAAGACAGAGAAACGGAGCCGGCGACCGCTGGGGC
hide sequence
RefSeq Acc Id:
XM_006253303 ⟹ XP_006253365
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 72,943,527 - 72,966,791 (+) NCBI mRatBN7.2 16 66,242,205 - 66,264,064 (+) NCBI Rnor_6.0 16 71,011,315 - 71,033,171 (+) NCBI Rnor_5.0 16 70,675,994 - 70,697,849 (+) NCBI
Sequence:
ACAGATGTGCTCTCGCGAGAGCTTGGGAAGTAGCAGCAATGGCGGCGACTGGAGTGGGTCCTGGCCCTGGAGTGGGCGCCGGCTCTGGTCCAGGAGCAGCTGCAAGTGCCACAACGACAGAAGACAGA
hide sequence
RefSeq Acc Id:
XM_006253304 ⟹ XP_006253366
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 72,945,180 - 72,966,791 (+) NCBI mRatBN7.2 16 66,242,465 - 66,264,064 (+) NCBI Rnor_6.0 16 71,011,594 - 71,033,171 (+) NCBI Rnor_5.0 16 70,675,994 - 70,697,849 (+) NCBI
Sequence:
CCGCTCGGTGCCGCCCTCCGGACCCAGGCCCTGCGGCCAACGGTTCGGCCTGCCCGGTATCCTC
hide sequence
RefSeq Acc Id:
XM_063275243 ⟹ XP_063131313
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 72,945,180 - 72,966,791 (+) NCBI
RefSeq Acc Id:
NP_001099559 ⟸ NM_001106089
- UniProtKB:
A6IW01 (UniProtKB/TrEMBL), A0A8I6ASM7 (UniProtKB/TrEMBL)
- Sequence:
MAATGVGPGPGVGAGSGPGAAASATTTEDRETEPATAGAGEGPSAAPGAEPSSGEAESGDANLVDVSGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDT
hide sequence
RefSeq Acc Id:
XP_006253365 ⟸ XM_006253303
- Peptide Label:
isoform X1
- UniProtKB:
D3ZTV7 (UniProtKB/TrEMBL), A0A8I6ASM7 (UniProtKB/TrEMBL)
- Sequence:
MAATGVGPGPGVGAGSGPGAAASATTTEDRETEPATAGAGEGPSAAPGAEPSSGEAESGDANLVDVSGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDT
hide sequence
RefSeq Acc Id:
XP_006253366 ⟸ XM_006253304
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2JT90 (UniProtKB/TrEMBL)
- Sequence:
MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNN
hide sequence
Ensembl Acc Id:
ENSRNOP00000020181 ⟸ ENSRNOT00000020181
Ensembl Acc Id:
ENSRNOP00000068617 ⟸ ENSRNOT00000086891
Ensembl Acc Id:
ENSRNOP00000094978 ⟸ ENSRNOT00000100676
RefSeq Acc Id:
XP_063131313 ⟸ XM_063275243
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2JT90 (UniProtKB/TrEMBL)
RGD ID: 13700171 Promoter ID: EPDNEW_R10688 Type: multiple initiation site Name: Ash2l_1 Description: ASH2 like histone lysine methyltransferase complex subunit SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 71,011,339 - 71,011,399 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-11
Ash2l
ASH2 like histone lysine methyltransferase complex subunit
Ash2l
ash2 (absent, small, or homeotic)-like (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Ash2l
ash2 (absent, small, or homeotic)-like (Drosophila)
Ash2l_predicted
ash2 (absent, small, or homeotic)-like (Drosophila) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Ash2l_predicted
ash2 (absent, small, or homeotic)-like (Drosophila) (predicted)
Symbol and Name status set to approved
70820 APPROVED
