Symbol:
Batf
Name:
basic leucine zipper ATF-like transcription factor
RGD ID:
1304923
Description:
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including DNA damage response, signal transduction by p53 class mediator; hemopoiesis; and positive regulation of macromolecule biosynthetic process. Predicted to be located in cytoplasm and nucleoplasm. Predicted to be part of RNA polymerase II transcription regulator complex. Predicted to be active in nucleus. Orthologous to human BATF (basic leucine zipper ATF-like transcription factor); INTERACTS WITH 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
B-ATF; B-cell-activating transcription factor; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcriptional factor ATF-like; LOC299206
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BATF (basic leucine zipper ATF-like transcription factor) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Batf (basic leucine zipper transcription factor, ATF-like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Batf (basic leucine zipper ATF-like transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BATF (basic leucine zipper ATF-like transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BATF (basic leucine zipper ATF-like transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Batf (basic leucine zipper ATF-like transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BATF (basic leucine zipper ATF-like transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BATF (basic leucine zipper ATF-like transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Batf (basic leucine zipper ATF-like transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
BATF (basic leucine zipper ATF-like transcription factor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Batf (basic leucine zipper transcription factor, ATF-like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
batf (basic leucine zipper transcription factor, ATF-like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
batf
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 111,084,717 - 111,107,052 (+) NCBI GRCr8 mRatBN7.2 6 105,353,715 - 105,376,051 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 105,353,715 - 105,376,051 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 105,523,736 - 105,546,059 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 105,822,615 - 105,844,937 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 105,192,265 - 105,214,586 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 109,562,415 - 109,584,541 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 109,562,587 - 109,584,545 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 118,868,534 - 118,890,817 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 109,793,076 - 109,817,614 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 109,752,161 - 109,821,070 (+) NCBI Celera 6 103,181,553 - 103,203,804 (+) NCBI Celera Cytogenetic Map 6 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Batf Rat 1,2-dimethylhydrazine increases expression ISO Batf (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of BATF mRNA CTD PMID:22206623 Batf Rat 17beta-estradiol 3-benzoate decreases methylation EXP 6480464 estradiol 3-benzoate results in decreased methylation of BATF promoter CTD PMID:27415467 Batf Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Batf (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BATF mRNA CTD PMID:24058054 Batf Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BATF mRNA CTD PMID:34747641 Batf Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Batf (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BATF mRNA CTD PMID:37172768 Batf Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO BATF (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of BATF mRNA CTD PMID:22903824 Batf Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Batf (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Batf Rat 4,4'-diaminodiphenylmethane decreases expression ISO Batf (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of BATF mRNA CTD PMID:18648102 Batf Rat 4,4'-sulfonyldiphenol increases expression ISO Batf (Mus musculus) 6480464 bisphenol S results in increased expression of BATF mRNA CTD PMID:30951980 Batf Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of BATF mRNA CTD PMID:31881176 Batf Rat aflatoxin B1 increases expression ISO BATF (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of BATF mRNA CTD PMID:27153756 Batf Rat all-trans-retinoic acid increases expression ISO BATF (Homo sapiens) 6480464 Tretinoin results in increased expression of BATF mRNA CTD PMID:33167477 Batf Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of BATF mRNA and [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of BATF mRNA CTD PMID:35163327 Batf Rat antirheumatic drug decreases expression ISO BATF (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of BATF mRNA CTD PMID:24449571 Batf Rat benzo[a]pyrene increases expression ISO BATF (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of BATF mRNA CTD PMID:21871943 and PMID:22316170 Batf Rat benzo[a]pyrene affects methylation ISO BATF (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BATF promoter CTD PMID:27901495 Batf Rat benzo[a]pyrene decreases methylation ISO BATF (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of BATF 5' UTR CTD PMID:27901495 Batf Rat benzo[a]pyrene multiple interactions ISO Batf (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BATF mRNA CTD PMID:27858113 Batf Rat benzo[b]fluoranthene multiple interactions ISO Batf (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BATF mRNA CTD PMID:27858113 Batf Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of BATF promoter CTD PMID:23359474 Batf Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of BATF promoter CTD PMID:23359474 Batf Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BATF mRNA CTD PMID:34947998 Batf Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BATF mRNA CTD PMID:30816183 Batf Rat bisphenol A affects methylation ISO Batf (Mus musculus) 6480464 bisphenol A affects the methylation of BATF promoter CTD PMID:27334623 Batf Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of BATF mRNA CTD PMID:25181051 Batf Rat carbon nanotube increases expression ISO Batf (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Batf Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of BATF mRNA CTD PMID:18500788 Batf Rat CGP 52608 multiple interactions ISO BATF (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BATF gene] CTD PMID:28238834 Batf Rat chlorpyrifos increases expression ISO Batf (Mus musculus) 6480464 Chlorpyrifos results in increased expression of BATF mRNA CTD PMID:37019170 Batf Rat choline multiple interactions ISO Batf (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BATF mRNA CTD PMID:20938992 Batf Rat chrysene multiple interactions ISO Batf (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BATF mRNA CTD PMID:27858113 Batf Rat clodronic acid decreases expression ISO BATF (Homo sapiens) 6480464 Clodronic Acid results in decreased expression of BATF mRNA CTD PMID:25596134 Batf Rat clofibrate multiple interactions ISO Batf (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of BATF mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of BATF mRNA] CTD PMID:17585979 Batf Rat copper(II) sulfate increases expression ISO BATF (Homo sapiens) 6480464 Copper Sulfate results in increased expression of BATF mRNA CTD PMID:19549813 Batf Rat cyclosporin A increases expression ISO BATF (Homo sapiens) 6480464 Cyclosporine results in increased expression of BATF mRNA CTD PMID:25562108 Batf Rat cylindrospermopsin increases expression ISO BATF (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of BATF mRNA CTD PMID:24921660 Batf Rat dibenz[a,h]anthracene decreases expression ISO Batf (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Batf Rat Dibutyl phosphate affects expression ISO BATF (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of BATF mRNA CTD PMID:37042841 Batf Rat dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of BATF promoter CTD PMID:23359474 Batf Rat dioxygen multiple interactions ISO Batf (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of BATF mRNA CTD PMID:30529165 Batf Rat elemental selenium increases expression ISO BATF (Homo sapiens) 6480464 Selenium results in increased expression of BATF mRNA CTD PMID:19244175 Batf Rat folic acid multiple interactions ISO Batf (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BATF mRNA CTD PMID:20938992 Batf Rat genistein increases expression ISO Batf (Mus musculus) 6480464 Genistein results in increased expression of BATF mRNA CTD PMID:32186404 Batf Rat Indeno[1,2,3-cd]pyrene multiple interactions ISO Batf (Mus musculus) 6480464 [indeno(1 more ... CTD PMID:36975775 Batf Rat L-methionine multiple interactions ISO Batf (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BATF mRNA CTD PMID:20938992 Batf Rat menadione increases expression ISO Batf (Mus musculus) 6480464 Vitamin K 3 results in increased expression of BATF mRNA CTD PMID:25270620 Batf Rat nickel atom increases expression ISO BATF (Homo sapiens) 6480464 Nickel results in increased expression of BATF mRNA CTD PMID:24768652 and PMID:25583101 Batf Rat nitrates multiple interactions ISO Batf (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of BATF mRNA CTD PMID:35964746 Batf Rat ozone increases expression ISO BATF (Homo sapiens) 6480464 Ozone results in increased expression of BATF mRNA CTD PMID:23033980 Batf Rat paracetamol multiple interactions ISO Batf (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of BATF mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of BATF mRNA] CTD PMID:17585979 Batf Rat perfluorohexanesulfonic acid increases expression ISO Batf (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of BATF mRNA CTD PMID:37995155 Batf Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of BATF mRNA and [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of BATF mRNA CTD PMID:35163327 Batf Rat pirinixic acid decreases expression ISO Batf (Mus musculus) 6480464 pirinixic acid results in decreased expression of BATF mRNA CTD PMID:20813756 Batf Rat protein kinase inhibitor multiple interactions ISO BATF (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of BATF mRNA] CTD PMID:28003376 Batf Rat selenium atom increases expression ISO BATF (Homo sapiens) 6480464 Selenium results in increased expression of BATF mRNA CTD PMID:19244175 Batf Rat silicon dioxide increases expression ISO BATF (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of BATF mRNA CTD PMID:23806026 Batf Rat silicon dioxide increases expression ISO Batf (Mus musculus) 6480464 Silicon Dioxide results in increased expression of BATF mRNA CTD PMID:29341224 Batf Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of BATF mRNA CTD PMID:22431001 Batf Rat tetraphene multiple interactions ISO Batf (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BATF mRNA CTD PMID:27858113 Batf Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of BATF mRNA CTD PMID:34492290 Batf Rat titanium dioxide increases expression ISO Batf (Mus musculus) 6480464 titanium dioxide results in increased expression of BATF mRNA CTD PMID:23557971 Batf Rat titanium dioxide decreases expression ISO Batf (Mus musculus) 6480464 titanium dioxide results in decreased expression of BATF mRNA CTD PMID:35295148 Batf Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of BATF mRNA CTD PMID:30012374 Batf Rat trimellitic anhydride increases expression ISO Batf (Mus musculus) 6480464 trimellitic anhydride results in increased expression of BATF mRNA CTD PMID:19042947 Batf Rat urethane decreases expression ISO BATF (Homo sapiens) 6480464 Urethane results in decreased expression of BATF mRNA CTD PMID:28818685 Batf Rat valproic acid decreases expression ISO BATF (Homo sapiens) 6480464 Valproic Acid results in decreased expression of BATF mRNA CTD PMID:29154799 Batf Rat vincristine increases expression ISO BATF (Homo sapiens) 6480464 Vincristine results in increased expression of BATF mRNA CTD PMID:23649840 Batf Rat vitamin E increases expression ISO BATF (Homo sapiens) 6480464 Vitamin E results in increased expression of BATF mRNA CTD PMID:19244175
1,2-dimethylhydrazine (ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) antirheumatic drug (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) carbon nanotube (ISO) cefaloridine (EXP) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) chrysene (ISO) clodronic acid (ISO) clofibrate (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dioxygen (ISO) elemental selenium (ISO) folic acid (ISO) genistein (ISO) Indeno[1,2,3-cd]pyrene (ISO) L-methionine (ISO) menadione (ISO) nickel atom (ISO) nitrates (ISO) ozone (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) pirinixic acid (ISO) protein kinase inhibitor (ISO) selenium atom (ISO) silicon dioxide (EXP,ISO) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (EXP,ISO) trimellitic anhydride (ISO) urethane (ISO) valproic acid (ISO) vincristine (ISO) vitamin E (ISO)
Biological Process
biological_process (ND) defense response to protozoan (ISO,ISS) DNA damage response (ISO,ISS) DNA damage response, signal transduction by p53 class mediator (ISO,ISS) hematopoietic stem cell differentiation (ISO,ISS) isotype switching (ISO,ISS) lymphoid progenitor cell differentiation (ISO,ISS) myeloid dendritic cell differentiation (ISO,ISS) positive regulation of cytokine production (ISO,ISS) positive regulation of transcription by RNA polymerase II (ISO) regulation of transcription by RNA polymerase II (IBA) T-helper 17 cell differentiation (ISO,ISS) T-helper 17 cell lineage commitment (ISO,ISS) T-helper 2 cell differentiation (ISO,ISS)
Batf Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 111,084,717 - 111,107,052 (+) NCBI GRCr8 mRatBN7.2 6 105,353,715 - 105,376,051 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 105,353,715 - 105,376,051 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 105,523,736 - 105,546,059 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 105,822,615 - 105,844,937 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 105,192,265 - 105,214,586 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 109,562,415 - 109,584,541 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 109,562,587 - 109,584,545 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 118,868,534 - 118,890,817 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 109,793,076 - 109,817,614 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 109,752,161 - 109,821,070 (+) NCBI Celera 6 103,181,553 - 103,203,804 (+) NCBI Celera Cytogenetic Map 6 q31 NCBI
BATF Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 75,522,469 - 75,546,992 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 75,522,455 - 75,546,993 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 75,988,812 - 76,013,335 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 75,058,537 - 75,083,086 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 75,058,536 - 75,083,086 NCBI Celera 14 56,026,856 - 56,051,425 (+) NCBI Celera Cytogenetic Map 14 q24.3 NCBI HuRef 14 56,156,725 - 56,181,293 (+) NCBI HuRef CHM1_1 14 75,926,564 - 75,951,110 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 69,731,553 - 69,756,105 (+) NCBI T2T-CHM13v2.0
Batf Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 85,733,494 - 85,755,861 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 85,733,443 - 85,755,861 (+) Ensembl GRCm39 Ensembl GRCm38 12 85,686,720 - 85,709,087 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 85,686,669 - 85,709,087 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 87,027,670 - 87,050,037 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 86,575,823 - 86,598,190 (+) NCBI MGSCv36 mm8 Celera 12 87,146,468 - 87,168,966 (+) NCBI Celera Cytogenetic Map 12 D2 NCBI cM Map 12 39.78 NCBI
Batf Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955523 42,218 - 66,103 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955523 42,365 - 66,103 (-) NCBI ChiLan1.0 ChiLan1.0
BATF Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 76,606,588 - 76,631,386 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 75,822,909 - 75,847,891 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 56,075,768 - 56,100,749 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 74,919,115 - 74,943,652 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 74,919,115 - 74,943,652 (+) Ensembl panpan1.1 panPan2
BATF Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 48,537,036 - 48,561,154 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 48,220,828 - 48,244,133 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 48,762,172 - 48,785,468 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 48,762,223 - 48,785,160 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 48,435,017 - 48,458,307 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 48,456,502 - 48,479,787 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 48,852,769 - 48,876,074 (+) NCBI UU_Cfam_GSD_1.0
Batf Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 27,437,717 - 27,461,255 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936488 4,607,716 - 4,631,283 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936488 4,607,716 - 4,631,237 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BATF Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 98,670,211 - 98,692,230 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 98,670,211 - 98,692,230 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 104,503,160 - 104,524,738 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BATF Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 52,761,569 - 52,785,999 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 52,761,651 - 52,785,978 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 40,981,105 - 41,005,400 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Batf
.
Predicted Target Of
Count of predictions: 175 Count of miRNA genes: 127 Interacting mature miRNAs: 144 Transcripts: ENSRNOT00000011563 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 1331722 Thshl1 Thyroid stimulating hormone level QTL 1 11.7 0.0001 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 6 89762877 106752806 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
47
90
91
90
59
25
59
6
215
94
70
45
58
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011563 ⟹ ENSRNOP00000011563
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 105,353,715 - 105,376,051 (+) Ensembl Rnor_6.0 Ensembl 6 109,562,587 - 109,584,545 (+) Ensembl
RefSeq Acc Id:
NM_001106748 ⟹ NP_001100218
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 111,084,717 - 111,107,052 (+) NCBI mRatBN7.2 6 105,353,715 - 105,376,051 (+) NCBI Rnor_6.0 6 109,562,617 - 109,584,541 (+) NCBI Rnor_5.0 6 118,868,534 - 118,890,817 (+) NCBI RGSC_v3.4 6 109,793,076 - 109,817,614 (+) RGD Celera 6 103,181,553 - 103,203,804 (+) RGD
Sequence:
GCCTGTGCGCAAGCCCCAAAGTGAGCGAGATGTCCCTGTGGGGAGCAGTCCCTCTGCACCCCAGAGAGAGGAGGACGCAGGGGTCTATCGGAGATAGCTGCAGGACGAGCAGGGGAGGCACCTGTGGA
hide sequence
RefSeq Acc Id:
NP_001100218 ⟸ NM_001106748
- UniProtKB:
D4A7E1 (UniProtKB/Swiss-Prot)
- Sequence:
MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISSPRFQP
hide sequence
Ensembl Acc Id:
ENSRNOP00000011563 ⟸ ENSRNOT00000011563
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-01
Batf
basic leucine zipper ATF-like transcription factor
Batf
basic leucine zipper transcription factor, ATF-like
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Batf
basic leucine zipper transcription factor, ATF-like
Batf_predicted
basic leucine zipper transcription factor, ATF-like (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Batf_predicted
basic leucine zipper transcription factor, ATF-like (predicted)
Symbol and Name status set to approved
70820 APPROVED
