Advanced Search (OLGA)

Gene: Arl10 (ARF like GTPase 10) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Arl10

Name:

ARF like GTPase 10 (Ensembl:ADP-ribosylation factor like GTPase 10)

RGD ID:

1303298

Description:

Predicted to enable GTP binding activity and GTPase activity. Predicted to be located in mitochondrion. Orthologous to human ARL10 (ARF like GTPase 10); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ADP-ribosylation factor like GTPase 10; ADP-ribosylation factor-like 10; ADP-ribosylation factor-like protein 10

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ARL10 (ARF like GTPase 10)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Arl10 (ADP-ribosylation factor-like 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Arl10 (ARF like GTPase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ARL10 (ARF like GTPase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ARL10 (ADP ribosylation factor like GTPase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Arl10 (ARF like GTPase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ARL10 (ADP ribosylation factor like GTPase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ARL10 (ARF like GTPase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Arl10 (ARF like GTPase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ARL10 (ARF like GTPase 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Arl10 (ADP-ribosylation factor-like 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	arl10 (ADP-ribosylation factor-like 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):	arl10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	10,035,320 - 10,043,732 (-)	NCBI		GRCr8
mRatBN7.2	17	10,030,213 - 10,038,625 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	10,030,213 - 10,038,703 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	10,044,375 - 10,052,786 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	11,577,557 - 11,586,085 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	10,040,812 - 10,049,223 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	10,567,064 - 10,575,518 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	10,568,959 - 10,575,203 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	12,693,062 - 12,701,533 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	16,094,098 - 16,100,342 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	16,094,097 - 16,100,342 (-)	NCBI
Celera	17	10,105,092 - 10,111,341 (-)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Arl10	Rat	Ehlers-Danlos syndrome dermatosparaxis type		ISO	RGD:1344087	8554872	ClinVar Annotator: match by term: Ehlers-Danlos syndrome, dermatosparaxis type	ClinVar	PMID:16770806\|PMID:17090394\|PMID:21567906\|PMID:23599694\|PMID:23913520\|PMID:24819041\|PMID:28128410\|PMID:28492532\|PMID:33389145
Arl10	Rat	Sotos syndrome		ISO	RGD:1344087	8554872	ClinVar Annotator: match by term: Sotos syndrome	ClinVar	PMID:16770806\|PMID:17090394\|PMID:21567906\|PMID:23599694\|PMID:23913520\|PMID:24819041\|PMID:28128410\|PMID:28492532\|PMID:33389145

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Arl10	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ARL10 mRNA]	CTD	PMID:31150632
Arl10	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1551746	6480464	1,2-Dimethylhydrazine results in decreased expression of ARL10 mRNA	CTD	PMID:22206623
Arl10	Rat	17beta-estradiol	increases expression	ISO	RGD:1551746	6480464	Estradiol results in increased expression of ARL10 mRNA	CTD	PMID:39298647
Arl10	Rat	17beta-estradiol	increases expression	ISO	RGD:1344087	6480464	Estradiol results in increased expression of ARL10 mRNA	CTD	PMID:31614463
Arl10	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1551746	6480464	[Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in decreased methylation of ARL10 gene	CTD	PMID:21212295
Arl10	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of ARL10 mRNA	CTD	PMID:33387578
Arl10	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1551746	6480464	Tetrachlorodibenzodioxin affects the expression of ARL10 mRNA	CTD	PMID:21570461
Arl10	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	RGD:1551746	6480464	4,4'-diaminodiphenylmethane results in increased expression of ARL10 mRNA	CTD	PMID:18648102
Arl10	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	RGD:1551746	6480464	bisphenol S results in increased methylation of ARL10 exon	CTD	PMID:33297965
Arl10	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	RGD:1551746	6480464	bisphenol S affects the methylation of ARL10 gene	CTD	PMID:31683443
Arl10	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of ARL10 mRNA	CTD	PMID:22504374
Arl10	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of ARL10 mRNA	CTD	PMID:24780913
Arl10	Rat	acrylamide	decreases expression	ISO	RGD:1344087	6480464	Acrylamide results in decreased expression of ARL10 mRNA	CTD	PMID:32763439
Arl10	Rat	antirheumatic drug	increases expression	ISO	RGD:1344087	6480464	Antirheumatic Agents results in increased expression of ARL10 mRNA	CTD	PMID:24449571
Arl10	Rat	aristolochic acid A	decreases expression	ISO	RGD:1344087	6480464	aristolochic acid I results in decreased expression of ARL10 mRNA	CTD	PMID:33212167
Arl10	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1344087	6480464	Benzo(a)pyrene results in decreased methylation of ARL10 promoter	CTD	PMID:27901495
Arl10	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ARL10 mRNA	CTD	PMID:25181051
Arl10	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ARL10 mRNA	CTD	PMID:30816183\|PMID:32528016
Arl10	Rat	bisphenol F	increases expression	ISO	RGD:1551746	6480464	bisphenol F results in increased expression of ARL10 mRNA	CTD	PMID:38685157
Arl10	Rat	chloroprene	increases expression	EXP		6480464	Chloroprene results in increased expression of ARL10 mRNA	CTD	PMID:23125180
Arl10	Rat	choline	multiple interactions	ISO	RGD:1551746	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Arl10	Rat	copper atom	multiple interactions	ISO	RGD:1551746	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ...	CTD	PMID:15467011
Arl10	Rat	copper(0)	multiple interactions	ISO	RGD:1551746	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ...	CTD	PMID:15467011
Arl10	Rat	crocidolite asbestos	increases expression	ISO	RGD:1551746	6480464	Asbestos, Crocidolite results in increased expression of ARL10 mRNA	CTD	PMID:19446018
Arl10	Rat	decabromodiphenyl ether	decreases expression	EXP		6480464	decabromobiphenyl ether results in decreased expression of ARL10 mRNA	CTD	PMID:23640034
Arl10	Rat	dioxygen	increases expression	ISO	RGD:1344087	6480464	Oxygen deficiency results in increased expression of ARL10 mRNA	CTD	PMID:25596134
Arl10	Rat	dorsomorphin	multiple interactions	ISO	RGD:1344087	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Arl10	Rat	doxorubicin	decreases expression	ISO	RGD:1344087	6480464	Doxorubicin results in decreased expression of ARL10 mRNA	CTD	PMID:29803840
Arl10	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of ARL10 mRNA	CTD	PMID:29391264
Arl10	Rat	epoxiconazole	increases expression	ISO	RGD:1551746	6480464	epoxiconazole results in increased expression of ARL10 mRNA	CTD	PMID:35436446
Arl10	Rat	folic acid	multiple interactions	ISO	RGD:1551746	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Arl10	Rat	formaldehyde	decreases expression	ISO	RGD:1344087	6480464	Formaldehyde results in decreased expression of ARL10 mRNA	CTD	PMID:27905399
Arl10	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of ARL10 mRNA	CTD	PMID:33387578
Arl10	Rat	GSK-J4	decreases expression	ISO	RGD:1344087	6480464	GSK-J4 results in decreased expression of ARL10 mRNA	CTD	PMID:29301935
Arl10	Rat	L-methionine	multiple interactions	ISO	RGD:1551746	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Arl10	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1551746	6480464	[Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in decreased methylation of ARL10 gene	CTD	PMID:21212295
Arl10	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of ARL10 mRNA	CTD	PMID:22504374
Arl10	Rat	nickel sulfate	decreases expression	ISO	RGD:1344087	6480464	nickel sulfate results in decreased expression of ARL10 mRNA	CTD	PMID:22714537
Arl10	Rat	okadaic acid	decreases expression	ISO	RGD:1344087	6480464	Okadaic Acid results in decreased expression of ARL10 mRNA	CTD	PMID:38832940
Arl10	Rat	ozone	multiple interactions	ISO	RGD:1344087	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of ARL10 mRNA	CTD	PMID:35430440
Arl10	Rat	p-chloromercuribenzoic acid	decreases expression	ISO	RGD:1344087	6480464	p-Chloromercuribenzoic Acid results in decreased expression of ARL10 mRNA	CTD	PMID:26272509
Arl10	Rat	p-chloromercuribenzoic acid	multiple interactions	ISO	RGD:1344087	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Arl10	Rat	paracetamol	affects expression	ISO	RGD:1551746	6480464	Acetaminophen affects the expression of ARL10 mRNA	CTD	PMID:17562736
Arl10	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of ARL10 mRNA	CTD	PMID:33387578
Arl10	Rat	pirinixic acid	decreases expression	ISO	RGD:1551746	6480464	pirinixic acid results in decreased expression of ARL10 mRNA	CTD	PMID:17950772
Arl10	Rat	SB 431542	multiple interactions	ISO	RGD:1344087	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Arl10	Rat	sodium arsenite	decreases expression	ISO	RGD:1344087	6480464	sodium arsenite results in decreased expression of ARL10 mRNA	CTD	PMID:22714537
Arl10	Rat	sunitinib	increases expression	ISO	RGD:1344087	6480464	Sunitinib results in increased expression of ARL10 mRNA	CTD	PMID:31533062
Arl10	Rat	testosterone	decreases expression	ISO	RGD:1344087	6480464	Testosterone results in decreased expression of ARL10 mRNA	CTD	PMID:33359661
Arl10	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ARL10 mRNA]	CTD	PMID:31150632
Arl10	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of ARL10 mRNA	CTD	PMID:31150632
Arl10	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of ARL10 mRNA	CTD	PMID:23411599
Arl10	Rat	thiram	increases expression	ISO	RGD:1344087	6480464	Thiram results in increased expression of ARL10 mRNA	CTD	PMID:38568856
Arl10	Rat	titanium dioxide	decreases methylation	ISO	RGD:1551746	6480464	titanium dioxide results in decreased methylation of ARL10 gene; titanium dioxide results in decreased methylation more ...	CTD	PMID:35295148
Arl10	Rat	triclosan	decreases expression	ISO	RGD:1344087	6480464	Triclosan results in decreased expression of ARL10 mRNA	CTD	PMID:30510588
Arl10	Rat	triphenyl phosphate	affects expression	ISO	RGD:1344087	6480464	triphenyl phosphate affects the expression of ARL10 mRNA	CTD	PMID:37042841
Arl10	Rat	triptonide	decreases expression	ISO	RGD:1551746	6480464	triptonide results in decreased expression of ARL10 mRNA	CTD	PMID:33045310
Arl10	Rat	trovafloxacin	increases expression	ISO	RGD:1551746	6480464	trovafloxacin results in increased expression of ARL10 mRNA	CTD	PMID:35537566
Arl10	Rat	valproic acid	increases methylation	ISO	RGD:1344087	6480464	Valproic Acid results in increased methylation of ARL10 gene	CTD	PMID:29154799
Arl10	Rat	valproic acid	increases expression	ISO	RGD:1344087	6480464	Valproic Acid results in increased expression of ARL10 mRNA	CTD	PMID:23179753

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Arl10	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Arl10	Rat	mitochondrion	located_in	ISO	RGD:1344087	9068941	PMID:34800366	FlyBase	PMID:34800366

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Arl10	Rat	GTP binding	enables	IEA	UniProtKB-KW:KW-0342	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Arl10	Rat	GTP binding	enables	IEA	InterPro:IPR006689	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Arl10	Rat	GTPase activity	enables	IEA	InterPro:IPR006689	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Arl10	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	GOA pipeline	RGD automated data pipeline
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:15033445	PMID:34800366

Arl10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	10,035,320 - 10,043,732 (-)	NCBI		GRCr8
mRatBN7.2	17	10,030,213 - 10,038,625 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	10,030,213 - 10,038,703 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	10,044,375 - 10,052,786 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	11,577,557 - 11,586,085 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	10,040,812 - 10,049,223 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	10,567,064 - 10,575,518 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	10,568,959 - 10,575,203 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	12,693,062 - 12,701,533 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	16,094,098 - 16,100,342 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	16,094,097 - 16,100,342 (-)	NCBI
Celera	17	10,105,092 - 10,111,341 (-)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

ARL10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	176,365,487 - 176,415,063 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	176,365,487 - 176,401,865 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	175,792,490 - 175,808,912 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	175,725,108 - 175,733,109 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	175,725,110 - 175,733,109	NCBI
Celera	5	172,701,905 - 172,709,953 (-)	NCBI		Celera
Cytogenetic Map	5	q35.2	NCBI
HuRef	5	170,717,012 - 170,725,052 (+)	NCBI		HuRef
CHM1_1	5	175,225,451 - 175,233,453 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	176,909,834 - 176,959,829 (+)	NCBI		T2T-CHM13v2.0

Arl10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	54,722,860 - 54,730,578 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	54,722,828 - 54,728,941 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	54,575,047 - 54,582,765 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	54,575,015 - 54,581,128 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	54,676,374 - 54,682,489 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	54,584,687 - 54,590,750 (+)	NCBI		MGSCv36	mm8
Celera	13	55,641,328 - 55,647,443 (+)	NCBI		Celera
Cytogenetic Map	13	B1	NCBI
cM Map	13	28.82	NCBI

Arl10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	28,670,670 - 28,678,711 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	28,671,451 - 28,678,711 (+)	NCBI	ChiLan1.0	ChiLan1.0

ARL10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	171,444,564 - 171,460,995 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	169,584,106 - 169,600,534 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	171,662,241 - 171,670,512 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	178,735,211 - 178,744,201 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

ARL10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	36,946,111 - 36,954,321 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	36,949,878 - 36,954,319 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	36,907,325 - 36,922,213 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	37,307,451 - 37,322,292 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	37,313,765 - 37,322,301 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	37,139,047 - 37,147,579 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	37,320,308 - 37,335,216 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	37,829,330 - 37,844,217 (-)	NCBI		UU_Cfam_GSD_1.0

Arl10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	121,611,057 - 121,626,500 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936597	635,937 - 652,761 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936597	635,967 - 651,604 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARL10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	81,496,825 - 81,506,329 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	81,496,823 - 81,506,344 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	83,148,227 - 83,157,753 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARL10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	78,368,593 - 78,377,869 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	78,369,699 - 78,375,855 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666075	9,498,138 - 9,506,540 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Arl10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	13,750,631 - 13,761,755 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	13,749,437 - 13,761,766 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Arl10
25 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	825
Count of miRNA genes:	301
Interacting mature miRNAs:	385
Transcripts:	ENSRNOT00000073186
Prediction methods:	Microtar, Miranda, Pita, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9991286	40540197	Rat
631499	Stl1	Serum triglyceride level QTL 1	3.6		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	3271398	27389946	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4354487	27028127	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2115149	34551001	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9201365	23653323	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31701463	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9201365	23653323	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	4299130	35837242	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811)	17	4299130	21293263	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	1	31990913	Rat
1581553	Pur14	Proteinuria QTL 14	5.3	0.0001	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	17	7979968	16317111	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	37830672	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9201365	23653323	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4354487	27028127	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1641902	Colcr7	Colorectal carcinoma resistance QTL 7	3.35	0.0044	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	17	2115149	21881669	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22871563	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001399321	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_207165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BK001709	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073186 ⟹ ENSRNOP00000066910

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	10,030,213 - 10,038,343 (-)	Ensembl
Rnor_6.0 Ensembl	17	10,568,959 - 10,575,203 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108677 ⟹ ENSRNOP00000095832

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	10,030,213 - 10,038,703 (-)	Ensembl

RefSeq Acc Id:

NM_001399321 ⟹ NP_001386250

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	10,035,320 - 10,043,732 (-)	NCBI
mRatBN7.2	17	10,030,213 - 10,038,625 (-)	NCBI

RefSeq Acc Id:

NM_207165 ⟹ NP_997048

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	10,035,320 - 10,043,450 (-)	NCBI
mRatBN7.2	17	10,030,213 - 10,038,343 (-)	NCBI
Rnor_6.0	17	10,568,959 - 10,575,203 (-)	NCBI
Rnor_5.0	17	12,693,062 - 12,701,533 (-)	NCBI
RGSC_v3.4	17	16,094,098 - 16,100,342 (-)	RGD
Celera	17	10,105,092 - 10,111,341 (-)	RGD

Sequence:

show sequence

AGTGCAAGTGCCAGGGCCGGGACAAGGCATCCGGCTAGGAAGCCCGGAGGGCGCGGCAGGAGCCAGCCAGGCACCAGTGCAGAAAGCGCGGTGGCGCCGCCCGGGGGATGCCCTCAGGCCCGGTGCGG
CTGATCGTGAGATCTTGGGATTGTCTTGGGCTTACTACTGTTAGAGGAAGCCAAGGATTTGTGATGGGGAAGAATGTGCGGGAGATCACGAGGAGTCAAAAGAAAACCGGAGGACGATGAAGATGAGC
CGGCATTGGAGGAACTGGAGCAACGCGAAGTGCTGGTGCTGGGCTTGGATGGCTCAGGGAAAAGCACGTTTCTGCGCATGCTGGCTGGGAAGCCACCGGTGGAAGGCCACGTCCCCACCTGGGGCTTC
AACTCTGTTCGGCTGCCTACCAAGAATTTCGAGGTGGACCTGTTAGAGATTGGTGGCAGCCAGAACCTGCGCTTCTACTGGAAGGAGTTTGTGAATGAGGTGGACGTGCTGGTGTTCATGGTGGACTC
GACTGACCGGCTAAGGTTGCCCTGGGCTCGGCAGGAGCTGCAGAAACTGCTGGACAAGGATCCTGACCTGCCTGTTGTCATAGTGGCCAACAAGCAAGACCTGAGTGGAGCCATGAGTATGGTGGAGC
TGCAGCAGGAGCTGGGCCTCCTTGCTAGTGACAACCAGAGAGAGGTTTTCCTCTTGGCAGCCAGCATTGCCCCTGCAGGATCTGGCTTCGAGGAACCCGGCACCGTGCGCATCTGGAAATTGCTCTTG
GAGCTTCTCTCCTAG

hide sequence


Protein RefSeqs	NP_001386250	(Get FASTA)	NCBI Sequence Viewer
	NP_997048	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	DAA02251	(Get FASTA)	NCBI Sequence Viewer
	EDL94046	(Get FASTA)	NCBI Sequence Viewer
	EDL94047	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066910
	ENSRNOP00000066910.1
	ENSRNOP00000095832
	ENSRNOP00000095832.1

RefSeq Acc Id:	NP_997048 ⟸ NM_207165
- Peptide Label:	isoform 2
- UniProtKB:	Q6IMA8 (UniProtKB/TrEMBL), A6KAY9 (UniProtKB/TrEMBL), M0RBH4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MCGRSRGVKRKPEDDEDEPALEELEQREVLVLGLDGSGKSTFLRMLAGKPPVEGHVPTWGFNSVRLPTKNFEVDLLEIGGSQNLRFYWKEFVNEVDVLVFMVDSTDRLRLPWARQELQKLLDKDPDLP VVIVANKQDLSGAMSMVELQQELGLLASDNQREVFLLAASIAPAGSGFEEPGTVRIWKLLLELLS hide sequence

Ensembl Acc Id:

ENSRNOP00000066910 ⟸ ENSRNOT00000073186

Ensembl Acc Id:

ENSRNOP00000095832 ⟸ ENSRNOT00000108677

RefSeq Acc Id:	NP_001386250 ⟸ NM_001399321
- Peptide Label:	isoform 1
- UniProtKB:	A6KAY8 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6IMA8-F1-model_v2	AlphaFold	Q6IMA8	1-193	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-10173	BioCyc
Ensembl Genes	ENSRNOG00000045948	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000073186	ENTREZGENE
	ENSRNOT00000073186.3	UniProtKB/TrEMBL
	ENSRNOT00000108677	ENTREZGENE
	ENSRNOT00000108677.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
InterPro	ARF/SAR	UniProtKB/TrEMBL
	ARL10	UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/TrEMBL
NCBI Gene	306767	ENTREZGENE
PANTHER	ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 10	UniProtKB/TrEMBL
	PTHR47575	UniProtKB/TrEMBL
Pfam	Arf	UniProtKB/TrEMBL
PhenoGen	Arl10	PhenoGen
PRINTS	SAR1GTPBP	UniProtKB/TrEMBL
PROSITE	ARF	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000045948	RatGTEx
SMART	ARF	UniProtKB/TrEMBL
	SAR	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A8I6AS90_RAT	UniProtKB/TrEMBL
	A6KAY8	ENTREZGENE, UniProtKB/TrEMBL
	A6KAY9	ENTREZGENE, UniProtKB/TrEMBL
	M0RBH4	ENTREZGENE, UniProtKB/TrEMBL
	Q6IMA8	ENTREZGENE
UniProt Secondary	Q6IMA8	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-11-07	Arl10	ARF like GTPase 10	Arl10	ADP-ribosylation factor like GTPase 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-12-09	Arl10	ADP-ribosylation factor like GTPase 10	Arl10	ADP-ribosylation factor-like 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Arl10	ADP-ribosylation factor-like 10			Symbol and Name status set to approved	1299863	APPROVED
2005-09-30	Arl10				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar