Symbol:
Slc12a4
Name:
solute carrier family 12, member 4
RGD ID:
736768
MGI Page
MGI
Description:
Enables potassium:chloride symporter activity. Involved in potassium ion transmembrane transport. Predicted to be located in membrane. Predicted to be active in plasma membrane. Is expressed in several structures, including adrenal gland; genitourinary system; nervous system; retina; and spleen. Orthologous to human SLC12A4 (solute carrier family 12 member 4).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AW546649; electroneutral potassium-chloride cotransporter 1; erythroid K-Cl cotransporter 1; K-Cl Co-transporter-1; K-Cl cotransporter KCC1; KCC1; mKCC1; RBCKCC1; solute carrier family 12 member 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC12A4 (solute carrier family 12 member 4) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Slc12a4 (solute carrier family 12 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc12a4 (solute carrier family 12 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC12A4 (solute carrier family 12 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC12A4 (solute carrier family 12 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc12a4 (solute carrier family 12 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC12A4 (solute carrier family 12 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC12A4 (solute carrier family 12 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc12a4 (solute carrier family 12 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SLC12A5 (solute carrier family 12 member 5) HGNC
OrthoMCL
Homo sapiens (human):
SLC12A6 (solute carrier family 12 member 6) HGNC
OrthoMCL
Homo sapiens (human):
SLC12A7 (solute carrier family 12 member 7) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Slc12a4 (solute carrier family 12 member 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SLC12A4 (solute carrier family 12 member 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc12a4 (solute carrier family 12 member 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
kcc
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
kcc-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
slc12a4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 106,670,222 - 106,692,781 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 106,670,222 - 106,692,729 (-) Ensembl GRCm39 Ensembl GRCm38 8 105,943,590 - 105,966,149 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 105,943,590 - 105,966,097 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 108,467,493 - 108,489,939 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 108,832,722 - 108,855,168 (-) NCBI MGSCv36 mm8 Celera 8 110,171,642 - 110,194,085 (-) NCBI Celera Cytogenetic Map 8 D3 NCBI cM Map 8 53.06 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc12a4 Mouse (+)-schisandrin B multiple interactions ISO Slc12a4 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of SLC12A4 mRNA] CTD PMID:31150632 Slc12a4 Mouse 1,1-dichloroethene increases expression EXP 6480464 vinylidene chloride results in increased expression of SLC12A4 mRNA CTD PMID:26682919 Slc12a4 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of SLC12A4 mRNA CTD PMID:28960355 Slc12a4 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of SLC12A4 mRNA CTD PMID:22206623 Slc12a4 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of SLC12A4 mRNA CTD PMID:22206623 Slc12a4 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SLC12A4 mRNA CTD PMID:17942748 Slc12a4 Mouse 17beta-estradiol increases expression ISO SLC12A4 (Homo sapiens) 6480464 Estradiol results in increased expression of SLC12A4 mRNA CTD PMID:19167446 Slc12a4 Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO Slc12a4 (Rattus norvegicus) 6480464 2 more ... CTD PMID:27291303 Slc12a4 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SLC12A4 mRNA CTD PMID:21570461 Slc12a4 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Slc12a4 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC12A4 mRNA CTD PMID:33387578 Slc12a4 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLC12A4 mRNA CTD PMID:33956508 Slc12a4 Mouse 2,4-dinitrotoluene affects expression ISO Slc12a4 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of SLC12A4 mRNA CTD PMID:21346803 Slc12a4 Mouse 2,6-dinitrotoluene affects expression ISO Slc12a4 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of SLC12A4 mRNA CTD PMID:21346803 Slc12a4 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of SLC12A4 mRNA CTD PMID:39298647 Slc12a4 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of SLC12A4 gene CTD PMID:31683443 Slc12a4 Mouse 5-aza-2'-deoxycytidine increases expression ISO SLC12A4 (Homo sapiens) 6480464 Decitabine results in increased expression of SLC12A4 mRNA CTD PMID:17908484 Slc12a4 Mouse 6-propyl-2-thiouracil decreases expression ISO Slc12a4 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of SLC12A4 mRNA CTD PMID:25825206 Slc12a4 Mouse acrylamide decreases expression ISO SLC12A4 (Homo sapiens) 6480464 Acrylamide results in decreased expression of SLC12A4 mRNA CTD PMID:32763439 Slc12a4 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of SLC12A4 mRNA CTD PMID:19770486 Slc12a4 Mouse all-trans-retinoic acid increases expression ISO SLC12A4 (Homo sapiens) 6480464 Tretinoin results in increased expression of SLC12A4 mRNA CTD PMID:23724009 Slc12a4 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of SLC12A4 mRNA CTD PMID:30951980 Slc12a4 Mouse amiloride multiple interactions EXP 6480464 Amiloride inhibits the reaction [SLC12A4 protein results in increased transport of Potassium] CTD PMID:11703599 Slc12a4 Mouse ammonium chloride affects expression ISO Slc12a4 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of SLC12A4 mRNA CTD PMID:16483693 Slc12a4 Mouse arsane multiple interactions ISO SLC12A4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SLC12A4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SLC12A4 mRNA CTD PMID:39836092 Slc12a4 Mouse arsenic atom multiple interactions ISO SLC12A4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SLC12A4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SLC12A4 mRNA CTD PMID:39836092 Slc12a4 Mouse arsenite(3-) increases expression EXP 6480464 arsenite results in increased expression of SLC12A4 protein CTD PMID:37955338 Slc12a4 Mouse Azoxymethane multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC12A4 mRNA CTD PMID:29950665 Slc12a4 Mouse barium(0) multiple interactions EXP 6480464 Barium inhibits the reaction [SLC12A4 protein results in increased transport of Potassium] CTD PMID:11703599 Slc12a4 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SLC12A4 mRNA CTD PMID:22610609 Slc12a4 Mouse benzo[a]pyrene increases expression ISO SLC12A4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of SLC12A4 mRNA CTD PMID:32234424 Slc12a4 Mouse benzo[a]pyrene increases methylation ISO SLC12A4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SLC12A4 promoter CTD PMID:27901495 Slc12a4 Mouse benzo[a]pyrene affects methylation ISO SLC12A4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SLC12A4 exon CTD PMID:27901495 Slc12a4 Mouse benzo[b]fluoranthene increases expression EXP 6480464 benzo(b)fluoranthene results in increased expression of SLC12A4 mRNA CTD PMID:26377693 Slc12a4 Mouse bisphenol A increases expression ISO Slc12a4 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of SLC12A4 mRNA CTD PMID:25181051 Slc12a4 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC12A4 mRNA CTD PMID:33221593 Slc12a4 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC12A4 mRNA CTD PMID:29161229 Slc12a4 Mouse bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of SLC12A4 promoter CTD PMID:27312807 Slc12a4 Mouse bisphenol A decreases expression ISO Slc12a4 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SLC12A4 mRNA CTD PMID:30816183 more ... Slc12a4 Mouse Bisphenol B increases expression ISO SLC12A4 (Homo sapiens) 6480464 bisphenol B results in increased expression of SLC12A4 protein CTD PMID:34186270 Slc12a4 Mouse bisphenol F multiple interactions EXP 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of SLC12A4 mRNA CTD PMID:30951980 Slc12a4 Mouse bisphenol F increases expression ISO SLC12A4 (Homo sapiens) 6480464 bisphenol F results in increased expression of SLC12A4 protein CTD PMID:34186270 Slc12a4 Mouse caffeine decreases phosphorylation ISO SLC12A4 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of SLC12A4 protein CTD PMID:35688186 Slc12a4 Mouse chlorpyrifos multiple interactions ISO Slc12a4 (Rattus norvegicus) 6480464 FMR1 inhibits the reaction [Chlorpyrifos results in increased expression of SLC12A4 mRNA] CTD PMID:35802248 Slc12a4 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of SLC12A4 gene CTD PMID:20938992 Slc12a4 Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of SLC12A4 mRNA CTD PMID:17585979 Slc12a4 Mouse copper atom increases expression ISO Slc12a4 (Rattus norvegicus) 6480464 Copper results in increased expression of SLC12A4 mRNA CTD PMID:30556269 Slc12a4 Mouse copper(0) increases expression ISO Slc12a4 (Rattus norvegicus) 6480464 Copper results in increased expression of SLC12A4 mRNA CTD PMID:30556269 Slc12a4 Mouse coumestrol multiple interactions ISO SLC12A4 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Slc12a4 Mouse coumestrol increases expression ISO SLC12A4 (Homo sapiens) 6480464 Coumestrol results in increased expression of SLC12A4 mRNA CTD PMID:19167446 Slc12a4 Mouse Cuprizon increases expression ISO Slc12a4 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of SLC12A4 mRNA CTD PMID:26577399 Slc12a4 Mouse dextran sulfate multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC12A4 mRNA CTD PMID:29950665 Slc12a4 Mouse diazinon affects expression ISO Slc12a4 (Rattus norvegicus) 6480464 Diazinon affects the expression of SLC12A4 mRNA CTD PMID:22546817 Slc12a4 Mouse Dibutyl phosphate affects expression ISO SLC12A4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SLC12A4 mRNA CTD PMID:37042841 Slc12a4 Mouse dieldrin affects expression ISO Slc12a4 (Rattus norvegicus) 6480464 Dieldrin affects the expression of SLC12A4 mRNA CTD PMID:22546817 Slc12a4 Mouse diuron decreases expression ISO Slc12a4 (Rattus norvegicus) 6480464 Diuron results in decreased expression of SLC12A4 mRNA CTD PMID:25152437 Slc12a4 Mouse doxorubicin increases expression ISO SLC12A4 (Homo sapiens) 6480464 Doxorubicin results in increased expression of SLC12A4 mRNA CTD PMID:29803840 Slc12a4 Mouse Enterolactone multiple interactions ISO SLC12A4 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of SLC12A4 mRNA CTD PMID:19167446 Slc12a4 Mouse epoxiconazole decreases expression EXP 6480464 epoxiconazole results in decreased expression of SLC12A4 mRNA CTD PMID:35436446 Slc12a4 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of SLC12A4 mRNA CTD PMID:30319688 Slc12a4 Mouse fenamidone increases expression EXP 6480464 fenamidone results in increased expression of SLC12A4 mRNA CTD PMID:27029645 Slc12a4 Mouse folic acid multiple interactions EXP 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Slc12a4 Mouse FR900359 affects phosphorylation ISO SLC12A4 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of SLC12A4 protein CTD PMID:37730182 Slc12a4 Mouse genistein decreases expression ISO SLC12A4 (Homo sapiens) 6480464 Genistein results in decreased expression of SLC12A4 mRNA CTD PMID:16705744 Slc12a4 Mouse genistein decreases expression EXP 6480464 Genistein results in decreased expression of SLC12A4 mRNA CTD PMID:21048042 Slc12a4 Mouse gentamycin increases expression ISO Slc12a4 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of SLC12A4 mRNA CTD PMID:33387578 Slc12a4 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of SLC12A4 gene CTD PMID:20938992 Slc12a4 Mouse lead(0) affects expression ISO SLC12A4 (Homo sapiens) 6480464 Lead affects the expression of SLC12A4 mRNA CTD PMID:28903495 Slc12a4 Mouse leflunomide increases expression ISO SLC12A4 (Homo sapiens) 6480464 leflunomide results in increased expression of SLC12A4 mRNA CTD PMID:28988120 Slc12a4 Mouse magnesium atom affects expression EXP 6480464 Magnesium affects the expression of SLC12A4 mRNA CTD PMID:11703599 Slc12a4 Mouse magnesium atom multiple interactions EXP 6480464 Magnesium affects the reaction [SLC12A4 protein results in increased transport of Potassium] CTD PMID:11703599 Slc12a4 Mouse manganese atom multiple interactions ISO SLC12A4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SLC12A4 mRNA CTD PMID:39836092 Slc12a4 Mouse manganese(0) multiple interactions ISO SLC12A4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SLC12A4 mRNA CTD PMID:39836092 Slc12a4 Mouse manganese(II) chloride multiple interactions ISO SLC12A4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SLC12A4 mRNA CTD PMID:39836092 Slc12a4 Mouse methotrexate affects expression EXP 6480464 Methotrexate affects the expression of SLC12A4 mRNA CTD PMID:18502557 Slc12a4 Mouse N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SLC12A4 mRNA CTD PMID:22776087 Slc12a4 Mouse N-methyl-4-phenylpyridinium increases expression ISO SLC12A4 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SLC12A4 mRNA CTD PMID:24810058 Slc12a4 Mouse nickel dichloride affects expression ISO Slc12a4 (Rattus norvegicus) 6480464 nickel chloride affects the expression of SLC12A4 mRNA CTD PMID:22546817 Slc12a4 Mouse orphenadrine affects expression ISO Slc12a4 (Rattus norvegicus) 6480464 Orphenadrine affects the expression of SLC12A4 mRNA CTD PMID:23665939 Slc12a4 Mouse ozone multiple interactions ISO SLC12A4 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of SLC12A4 mRNA CTD PMID:35430440 Slc12a4 Mouse paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SLC12A4 mRNA CTD PMID:17585979 Slc12a4 Mouse paracetamol increases expression ISO Slc12a4 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of SLC12A4 mRNA CTD PMID:33387578 Slc12a4 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of SLC12A4 mRNA CTD PMID:17562736 Slc12a4 Mouse potassium atom multiple interactions EXP 6480464 Amiloride inhibits the reaction [SLC12A4 protein results in increased transport of Potassium] more ... CTD PMID:11703599 Slc12a4 Mouse potassium atom increases transport EXP 6480464 SLC12A4 protein results in increased transport of Potassium CTD PMID:11703599 Slc12a4 Mouse quercetin increases expression ISO SLC12A4 (Homo sapiens) 6480464 Quercetin results in increased expression of SLC12A4 mRNA CTD PMID:21632981 Slc12a4 Mouse quercetin increases phosphorylation ISO SLC12A4 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of SLC12A4 protein CTD PMID:35688186 Slc12a4 Mouse resveratrol multiple interactions ISO SLC12A4 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of SLC12A4 mRNA CTD PMID:19167446 Slc12a4 Mouse resveratrol increases expression ISO SLC12A4 (Homo sapiens) 6480464 resveratrol results in increased expression of SLC12A4 mRNA CTD PMID:25436977 Slc12a4 Mouse rotenone increases expression ISO SLC12A4 (Homo sapiens) 6480464 Rotenone results in increased expression of SLC12A4 mRNA CTD PMID:29955902 Slc12a4 Mouse sodium arsenite increases expression ISO SLC12A4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SLC12A4 mRNA CTD PMID:38568856 Slc12a4 Mouse sodium arsenite multiple interactions ISO SLC12A4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SLC12A4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SLC12A4 mRNA CTD PMID:39836092 Slc12a4 Mouse tetrachloromethane increases expression ISO Slc12a4 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of SLC12A4 mRNA CTD PMID:31150632 Slc12a4 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SLC12A4 mRNA CTD PMID:31919559 Slc12a4 Mouse tetrachloromethane multiple interactions ISO Slc12a4 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of SLC12A4 mRNA] CTD PMID:31150632 Slc12a4 Mouse thioacetamide increases expression ISO Slc12a4 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of SLC12A4 mRNA CTD PMID:34492290 Slc12a4 Mouse thiram increases expression ISO SLC12A4 (Homo sapiens) 6480464 Thiram results in increased expression of SLC12A4 mRNA CTD PMID:38568856 Slc12a4 Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of SLC12A4 mRNA CTD PMID:27760801 Slc12a4 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of SLC12A4 gene CTD PMID:35295148 Slc12a4 Mouse titanium dioxide multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC12A4 mRNA CTD PMID:29950665 Slc12a4 Mouse trichloroethene increases expression ISO Slc12a4 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of SLC12A4 mRNA CTD PMID:33387578 Slc12a4 Mouse triphenyl phosphate affects expression ISO SLC12A4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SLC12A4 mRNA CTD PMID:37042841 Slc12a4 Mouse valproic acid increases methylation ISO SLC12A4 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SLC12A4 gene CTD PMID:29154799 Slc12a4 Mouse zidovudine increases expression ISO SLC12A4 (Homo sapiens) 6480464 Zidovudine results in increased expression of SLC12A4 mRNA CTD PMID:24292225 Slc12a4 Mouse zinc atom increases expression ISO SLC12A4 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of SLC12A4 mRNA CTD PMID:18356318 Slc12a4 Mouse zinc(0) increases expression ISO SLC12A4 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of SLC12A4 mRNA CTD PMID:18356318
(+)-schisandrin B (ISO) 1,1-dichloroethene (EXP) 1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 4,4'-sulfonyldiphenol (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) aflatoxin B1 (EXP) all-trans-retinoic acid (EXP,ISO) amiloride (EXP) ammonium chloride (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (EXP) Azoxymethane (EXP) barium(0) (EXP) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) caffeine (ISO) chlorpyrifos (ISO) choline (EXP) clofibrate (EXP) copper atom (ISO) copper(0) (ISO) coumestrol (ISO) Cuprizon (ISO) dextran sulfate (EXP) diazinon (ISO) Dibutyl phosphate (ISO) dieldrin (ISO) diuron (ISO) doxorubicin (ISO) Enterolactone (ISO) epoxiconazole (EXP) ethanol (EXP) fenamidone (EXP) folic acid (EXP) FR900359 (ISO) genistein (EXP,ISO) gentamycin (ISO) L-methionine (EXP) lead(0) (ISO) leflunomide (ISO) magnesium atom (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methotrexate (EXP) N-methyl-4-phenylpyridinium (EXP,ISO) nickel dichloride (ISO) orphenadrine (ISO) ozone (ISO) paracetamol (EXP,ISO) potassium atom (EXP) quercetin (ISO) resveratrol (ISO) rotenone (ISO) sodium arsenite (ISO) tetrachloromethane (EXP,ISO) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) valproic acid (ISO) zidovudine (ISO) zinc atom (ISO) zinc(0) (ISO)
Slc12a4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 106,670,222 - 106,692,781 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 106,670,222 - 106,692,729 (-) Ensembl GRCm39 Ensembl GRCm38 8 105,943,590 - 105,966,149 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 105,943,590 - 105,966,097 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 108,467,493 - 108,489,939 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 108,832,722 - 108,855,168 (-) NCBI MGSCv36 mm8 Celera 8 110,171,642 - 110,194,085 (-) NCBI Celera Cytogenetic Map 8 D3 NCBI cM Map 8 53.06 NCBI
SLC12A4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 67,943,474 - 67,968,694 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 67,943,474 - 67,969,601 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 67,977,377 - 68,002,597 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 66,535,731 - 66,560,026 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 66,535,730 - 66,560,026 NCBI Celera 16 52,485,834 - 52,511,054 (-) NCBI Celera Cytogenetic Map 16 q22.1 NCBI HuRef 16 53,850,947 - 53,876,165 (-) NCBI HuRef CHM1_1 16 69,385,448 - 69,410,667 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 73,739,247 - 73,764,467 (-) NCBI T2T-CHM13v2.0
Slc12a4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 50,748,268 - 50,770,217 (-) NCBI GRCr8 mRatBN7.2 19 33,838,418 - 33,860,369 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 33,838,419 - 33,860,331 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 40,653,965 - 40,675,808 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 41,307,280 - 41,329,122 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 43,605,822 - 43,627,712 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 37,917,003 - 37,938,952 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 37,917,014 - 37,938,857 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 48,784,035 - 48,805,888 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 35,785,181 - 35,807,024 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 35,790,067 - 35,811,905 (-) NCBI Celera 19 33,265,978 - 33,287,821 (-) NCBI Celera Cytogenetic Map 19 q12 NCBI
Slc12a4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955484 8,749,194 - 8,772,599 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955484 8,749,194 - 8,772,599 (+) NCBI ChiLan1.0 ChiLan1.0
SLC12A4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 77,470,550 - 77,494,899 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 83,381,969 - 83,406,307 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 48,285,265 - 48,309,614 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 67,673,087 - 67,698,223 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 67,673,087 - 67,697,280 (-) Ensembl panpan1.1 panPan2
SLC12A4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 81,533,491 - 81,555,901 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 81,533,470 - 81,559,313 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 81,523,512 - 81,545,458 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 81,968,814 - 81,991,227 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 81,968,753 - 81,994,636 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 81,795,063 - 81,817,008 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 81,477,196 - 81,499,140 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 82,119,391 - 82,141,353 (+) NCBI UU_Cfam_GSD_1.0
Slc12a4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 41,269,207 - 41,291,720 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 18,297,394 - 18,321,892 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 18,297,394 - 18,319,191 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC12A4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 28,553,616 - 28,576,504 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 28,554,162 - 28,576,458 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 26,043,412 - 26,056,523 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC12A4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 59,472,831 - 59,495,690 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 59,472,874 - 59,495,669 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 22,198,442 - 22,221,522 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc12a4
.
Predicted Target Of
Count of predictions: 1081 Count of miRNA genes: 487 Interacting mature miRNAs: 584 Transcripts: ENSMUST00000034370, ENSMUST00000116429, ENSMUST00000132231, ENSMUST00000141326, ENSMUST00000143381 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300560 Tgl1_m triglyceride level 1 (mouse) Not determined 8 102486208 111650036 Mouse 4141435 Fbtq3_m femoral bone trait QTL 3 (mouse) Not determined 8 100965309 130127694 Mouse 11252141 Fdr2_m fat response to dietary restriction 2 (mouse) 8 98390634 130127694 Mouse 1357470 Obq16_m obesity QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1302105 Im1_m Immunoregulatory 1 (mouse) Not determined 8 99828531 130127694 Mouse 1301080 Sluc9_m susceptibility to lung cancer 9 (mouse) Not determined 8 99828531 130127694 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 14746994 Manh65_m mandible shape 65 (mouse) 8 106489629 130127694 Mouse 10412234 Nhdlq14_m non-HDL QTL 14 (mouse) Not determined 8 76411976 110412125 Mouse 1301766 Desp1_m despair 1 (mouse) Not determined 8 85486208 119486373 Mouse 1301253 Skmw2_m skeletal muscle weight 2 (mouse) Not determined 8 86443553 120443701 Mouse 1301316 Dntcs1_m dental caries susceptibility 1 (mouse) Not determined 8 103443553 127781786 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 1357708 Orq1_m ovulation rate QTL 1 (mouse) Not determined 8 71740461 124622354 Mouse 1300681 Pgia22_m proteoglycan induced arthritis 22 (mouse) Not determined 8 102486208 116025457 Mouse 10755519 Wbc1_m white blood cell count 1 (mouse) 8 82345783 116345783 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 1301581 Char2_m P. chabaudi malaria resistance QTL 2 (mouse) Not determined 8 79808806 113809031 Mouse 1301874 Hdlq16_m HDL QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1357494 Obsty2_m obesity 2 (mouse) Not determined 8 96245241 129745061 Mouse 10045619 Heal14_m wound healing/regeneration 14 (mouse) Not determined 8 86443553 120443701 Mouse 1300920 Pitm3_m prion incubation time 3 (mouse) Not determined 8 73929123 107929226 Mouse 12880431 Fgf23lq2_m FGF23 serum level QTL 2 (mouse) 8 97626632 130127694 Mouse 10755530 Wbc2_m white blood cell count 2 (mouse) 8 81819296 115819296 Mouse 1302049 Heal1_m wound healing/regeneration 1 (mouse) Not determined 8 86443553 120443701 Mouse 27226796 Scvln16_m sacral vertebrae length 2, 16 week (mouse) 8 89726628 130027694 Mouse 27095912 Pglq14_m pelvic girdle length QTL 14, 16 week (mouse) 8 74126628 126826739 Mouse 4142023 W3q5_m weight 3 weeks QTL 5 (mouse) Not determined 71740461 124622354 Mouse 1301099 Cbm2_m cerebellum weight 2 (mouse) Not determined 8 79245241 113245331 Mouse 1301481 Lith11_m lithogenic gene 11 (mouse) Not determined 8 98563635 130127694 Mouse 11532692 Sluc38a_m susceptibility to lung cancer 38a (mouse) 8 105033977 130127694 Mouse 11532691 Sluc38_m susceptibility to lung cancer 38 (mouse) 8 105033977 130127694 Mouse 1558890 Lith18_m lithogenic gene 18 (mouse) Not determined 8 76402145 110402251 Mouse
BB400374
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 D3 UniSTS cM Map 8 53.0 UniSTS Whitehead/MRC_RH 8 1241.39 UniSTS
AW546649
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 105,944,035 - 105,944,162 UniSTS GRCm38 MGSCv37 8 108,467,935 - 108,468,062 UniSTS GRCm37 Celera 8 110,172,084 - 110,172,211 UniSTS Cytogenetic Map 8 D3 UniSTS cM Map 8 53.0 UniSTS cM Map 8 53.0 UniSTS Whitehead/MRC_RH 8 1234.12 UniSTS
RH124920
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 105,943,862 - 105,943,943 UniSTS GRCm38 MGSCv37 8 108,467,762 - 108,467,843 UniSTS GRCm37 Celera 8 110,171,911 - 110,171,992 UniSTS Cytogenetic Map 8 D3 UniSTS cM Map 8 53.0 UniSTS cM Map 8 53.0 UniSTS
RH44404
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 105,947,490 - 105,947,877 UniSTS GRCm38 MGSCv37 8 108,471,390 - 108,471,777 UniSTS GRCm37 Celera 8 110,175,538 - 110,175,925 UniSTS Cytogenetic Map 8 D3 UniSTS cM Map 8 53.0 UniSTS
RH125919
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 105,943,595 - 105,943,844 UniSTS GRCm38 MGSCv37 8 108,467,495 - 108,467,744 UniSTS GRCm37 Celera 8 110,171,644 - 110,171,893 UniSTS Cytogenetic Map 8 D3 UniSTS cM Map 8 51.0 UniSTS cM Map 8 53.0 UniSTS
Slc12a4
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 D3 UniSTS cM Map 8 53.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000034370 ⟹ ENSMUSP00000034370
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 106,670,225 - 106,692,729 (-) Ensembl GRCm38.p6 Ensembl 8 105,943,593 - 105,966,097 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000116429 ⟹ ENSMUSP00000112130
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 106,670,222 - 106,692,676 (-) Ensembl GRCm38.p6 Ensembl 8 105,943,590 - 105,966,044 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000132231 ⟹ ENSMUSP00000121018
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 106,680,515 - 106,691,052 (-) Ensembl GRCm38.p6 Ensembl 8 105,953,883 - 105,964,420 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000141326
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 106,673,323 - 106,674,805 (-) Ensembl GRCm38.p6 Ensembl 8 105,946,691 - 105,948,173 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000143381
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 106,687,092 - 106,692,706 (-) Ensembl GRCm38.p6 Ensembl 8 105,960,460 - 105,966,074 (-) Ensembl
RefSeq Acc Id:
NM_001253804 ⟹ NP_001240733
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 106,670,222 - 106,692,747 (-) NCBI GRCm38 8 105,943,590 - 105,966,115 (-) NCBI Celera 8 110,171,639 - 110,194,161 (-) ENTREZGENE cM Map 8 ENTREZGENE
Sequence:
GAGCGGGCGGGGCGGGCCAGCCTGGGGCGGCGGGGACTGCCGGCTGGAGGCCGGGACCGCGGGCCAAGCGCGCGCGATGCCTCACTTCACCGTGGTGCCGGTGGACGGGCCGCGACGCGGCGACTATG
hide sequence
RefSeq Acc Id:
NM_009195 ⟹ NP_033221
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 106,670,222 - 106,692,747 (-) NCBI GRCm38 8 105,943,590 - 105,966,115 (-) NCBI MGSCv37 8 108,467,493 - 108,489,939 (-) RGD Celera 8 110,171,639 - 110,194,161 (-) ENTREZGENE cM Map 8 ENTREZGENE
Sequence:
GAGCGGGCGGGGCGGGCCAGCCTGGGGCGGCGGGGACTGCCGGCTGGAGGCCGGGACCGCGGGCCAAGCGCGCGCGATGCCTCACTTCACCGTGGTGCCGGTGGACGGGCCGCGACGCGGCGACTATG
hide sequence
RefSeq Acc Id:
NR_045594
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 106,670,222 - 106,692,747 (-) NCBI GRCm38 8 105,943,590 - 105,966,115 (-) NCBI Celera 8 110,171,639 - 110,194,161 (-) ENTREZGENE cM Map 8 ENTREZGENE
Sequence:
GAGCGGGCGGGGCGGGCCAGCCTGGGGCGGCGGGGACTGCCGGCTGGAGGCCGGGACCGCGGGCCAAGCGCGCGCGATGCCTCACTTCACCGTGGTGCCGGTGGACGGGCCGCGACGCGGCGACTATG
hide sequence
RefSeq Acc Id:
XM_006530792 ⟹ XP_006530855
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 106,670,223 - 106,692,781 (-) NCBI GRCm38 8 105,943,591 - 105,966,149 (-) NCBI
Sequence:
GGGTGGAGGAAGTGAGCGCAGCGGGGTGGAATGCGAGCGGGCGGGGCGGGCCAGCCTGGGGCGGCGGGGACTGCCGGCTGGAGGCCGGGACCGCGGGCCAAGCGCGCGCGATGCCTCACTTCACCGTG
hide sequence
RefSeq Acc Id:
NP_033221 ⟸ NM_009195
- Peptide Label:
isoform 2
- UniProtKB:
O55069 (UniProtKB/Swiss-Prot), Q9ET57 (UniProtKB/Swiss-Prot), Q9JIS8 (UniProtKB/Swiss-Prot), Q3TWZ6 (UniProtKB/TrEMBL), Q3TLV0 (UniProtKB/TrEMBL), Q3TWV2 (UniProtKB/TrEMBL), Q3U9N0 (UniProtKB/TrEMBL), Q6NXV2 (UniProtKB/TrEMBL)
- Sequence:
MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAEREDSDGQGNHRENSPFLCPLDASRGNDYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGTLMGVYLPC
hide sequence
RefSeq Acc Id:
NP_001240733 ⟸ NM_001253804
- Peptide Label:
isoform 1
- UniProtKB:
F8WIJ0 (UniProtKB/TrEMBL), Q3UDQ8 (UniProtKB/TrEMBL)
- Sequence:
MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAEREDSDGEGQGNHRENSPFLCPLDASRGNDYY
hide sequence
RefSeq Acc Id:
XP_006530855 ⟸ XM_006530792
- Peptide Label:
isoform X1
- UniProtKB:
Q3TLV0 (UniProtKB/TrEMBL), Q3TWV2 (UniProtKB/TrEMBL), Q3U689 (UniProtKB/TrEMBL), Q3U9N0 (UniProtKB/TrEMBL), Q6NXV2 (UniProtKB/TrEMBL)
- Sequence:
MRAGGAGQPGAAGTAGWRPGPRAKRARCLTSPWCRWTGRDAATMTTSRGSVGWTTASAPSGKTRTEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGTLMGVYLPCLQNIF
hide sequence
Ensembl Acc Id:
ENSMUSP00000034370 ⟸ ENSMUST00000034370
Ensembl Acc Id:
ENSMUSP00000121018 ⟸ ENSMUST00000132231
Ensembl Acc Id:
ENSMUSP00000112130 ⟸ ENSMUST00000116429
RGD ID: 8668147 Promoter ID: EPDNEW_M12105 Type: initiation region Name: Slc12a4_1 Description: Mus musculus solute carrier family 12, member 4 , transcriptvariant 2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 105,966,068 - 105,966,128 EPDNEW
RGD ID: 6848345 Promoter ID: MM_ACW:48715 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lung Transcripts: SLC12A4.GSEP07-UNSPLICED Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 108,470,946 - 108,471,446 (-) MPROMDB
RGD ID: 6843723 Promoter ID: MM_KWN:55586 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: ES_Cell, Lung, MEF_B4, MEF_B6 Transcripts: OTTMUST00000076847 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 108,488,301 - 108,488,962 (-) MPROMDB
RGD ID: 6843720 Promoter ID: MM_KWN:55587 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000034370, OTTMUST00000076845, OTTMUST00000076846 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 108,489,576 - 108,490,076 (-) MPROMDB
Ensembl Genes ENSMUSG00000017765 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSMUST00000034370 ENTREZGENE
ENSMUST00000116429 ENTREZGENE
ENSMUST00000116429.9 UniProtKB/Swiss-Prot
Gene3D-CATH Amino acid/polyamine transporter I UniProtKB/Swiss-Prot
InterPro AA-permease/SLC12A_dom UniProtKB/Swiss-Prot
KCC1 UniProtKB/Swiss-Prot
KCL_cotranspt UniProtKB/Swiss-Prot
SLC12_C UniProtKB/Swiss-Prot
SLC12A_fam UniProtKB/Swiss-Prot
KEGG Report mmu:20498 UniProtKB/Swiss-Prot
MGD MGI:1309465 ENTREZGENE
NCBI Gene 20498 ENTREZGENE
PANTHER PTHR11827 UniProtKB/Swiss-Prot
PTHR11827:SF46 UniProtKB/Swiss-Prot
Pfam AA_permease UniProtKB/Swiss-Prot
SLC12 UniProtKB/Swiss-Prot
PhenoGen Slc12a4 PhenoGen
PRINTS KCLTRNSPORT UniProtKB/Swiss-Prot
KCLTRNSPORT1 UniProtKB/Swiss-Prot
UniProt F6TQE2_MOUSE UniProtKB/TrEMBL
F8WIJ0 ENTREZGENE, UniProtKB/TrEMBL
O55069 ENTREZGENE
Q3TJG5_MOUSE UniProtKB/TrEMBL
Q3TJM8_MOUSE UniProtKB/TrEMBL
Q3TLV0 ENTREZGENE, UniProtKB/TrEMBL
Q3TPD4_MOUSE UniProtKB/TrEMBL
Q3TWV2 ENTREZGENE, UniProtKB/TrEMBL
Q3TWZ6 ENTREZGENE, UniProtKB/TrEMBL
Q3U689 ENTREZGENE, UniProtKB/TrEMBL
Q3U9N0 ENTREZGENE, UniProtKB/TrEMBL
Q3UDQ8 ENTREZGENE, UniProtKB/TrEMBL
Q6NXV2 ENTREZGENE, UniProtKB/TrEMBL
Q920I2_MOUSE UniProtKB/TrEMBL
Q9ET57 ENTREZGENE
Q9JIS8 ENTREZGENE
Q9QY65_MOUSE UniProtKB/TrEMBL
S12A4_MOUSE UniProtKB/Swiss-Prot
UniProt Secondary O55069 UniProtKB/Swiss-Prot
Q9ET57 UniProtKB/Swiss-Prot
