Symbol:
Fabp7
Name:
fatty acid binding protein 7, brain
RGD ID:
736052
MGI Page
MGI
Description:
Predicted to enable fatty acid binding activity. Acts upstream of or within cell proliferation in forebrain; neurogenesis; and prepulse inhibition. Located in several cellular components, including cell projection; cell-cell junction; and neuronal cell body. Is expressed in several structures, including central nervous system; gut; olfactory system; peripheral nervous system; and retina. Orthologous to human FABP7 (fatty acid binding protein 7).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
B-FA; B-FABP; BFA; BFABP; Bl; Blbp; brain lipid binding protein; brain lipid-binding protein; brain-type fatty acid-binding protein; fatty acid-binding protein 7; fatty acid-binding protein, brain; mammary-derived growth inhibitor-related; MRG
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FABP7 (fatty acid binding protein 7)
HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Fabp7 (fatty acid binding protein 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fabp7 (fatty acid binding protein 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FABP7 (fatty acid binding protein 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FABP7 (fatty acid binding protein 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fabp7 (fatty acid binding protein 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FABP7 (fatty acid binding protein 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FABP7 (fatty acid binding protein 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fabp7 (fatty acid binding protein 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Fabp7 (fatty acid binding protein 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
FABP7 (fatty acid binding protein 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fabp7b (fatty acid binding protein 7, brain, b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
fabp7a (fatty acid binding protein 7, brain, a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
lbp-5
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
lbp-6
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
lbp-7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
lbp-8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
fabp
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fabp7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 57,661,019 - 57,664,546 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 57,660,977 - 57,664,546 (+) Ensembl GRCm39 Ensembl GRCm38 10 57,784,923 - 57,788,450 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 57,784,881 - 57,788,450 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 57,504,729 - 57,508,256 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 57,473,336 - 57,476,865 (+) NCBI MGSCv36 mm8 Celera 10 58,602,332 - 58,605,859 (+) NCBI Celera Cytogenetic Map 10 B4 NCBI cM Map 10 29.25 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fabp7 Mouse 1,1-dichloroethene decreases expression EXP 6480464 vinylidene chloride results in decreased expression of FABP7 mRNA CTD PMID:26682919 Fabp7 Mouse 1-chloro-2,4-dinitrobenzene affects expression EXP 6480464 Dinitrochlorobenzene affects the expression of FABP7 mRNA CTD PMID:22302311 Fabp7 Mouse 1-naphthyl isothiocyanate decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in decreased expression of FABP7 mRNA CTD PMID:25380136 and PMID:30723492 Fabp7 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of FABP7 mRNA CTD PMID:12072388 Fabp7 Mouse 17beta-estradiol increases expression ISO Fabp7 (Rattus norvegicus) 6480464 Estradiol results in increased expression of FABP7 mRNA and Estradiol results in increased expression of FABP7 protein CTD PMID:32145629 Fabp7 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO FABP7 (Homo sapiens) 6480464 2 more ... CTD PMID:30202865 Fabp7 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO FABP7 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FABP7 mRNA CTD PMID:21998131 Fabp7 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FABP7 mRNA CTD PMID:33956508 Fabp7 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FABP7 mRNA CTD PMID:21724226 and PMID:32109520 Fabp7 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Fabp7 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 2 more ... CTD PMID:19954255 Fabp7 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Fabp7 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:18550172 Fabp7 Mouse 2,4-dinitrotoluene decreases expression EXP 6480464 2 and 4-dinitrotoluene results in decreased expression of FABP7 mRNA CTD PMID:24893713 Fabp7 Mouse 2-palmitoylglycerol decreases expression ISO FABP7 (Homo sapiens) 6480464 2-palmitoylglycerol results in decreased expression of FABP7 mRNA CTD PMID:37199045 Fabp7 Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of FABP7 mRNA CTD PMID:25172293 Fabp7 Mouse 3H-1,2-dithiole-3-thione decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 1 and 2-dithiol-3-thione results in decreased expression of FABP7 mRNA CTD PMID:19162173 Fabp7 Mouse 4,4'-diaminodiphenylmethane decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of FABP7 mRNA CTD PMID:25380136 Fabp7 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of FABP7 mRNA CTD PMID:39298647 Fabp7 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Fabp7 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FABP7 mRNA CTD PMID:36041667 Fabp7 Mouse 5-fluorouracil decreases expression ISO FABP7 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of FABP7 mRNA CTD PMID:24737281 Fabp7 Mouse 6-propyl-2-thiouracil increases expression ISO Fabp7 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of FABP7 mRNA CTD PMID:24780913 Fabp7 Mouse 9-cis-retinoic acid decreases expression ISO FABP7 (Homo sapiens) 6480464 Alitretinoin results in decreased expression of FABP7 protein CTD PMID:36805303 Fabp7 Mouse acetamide decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 acetamide results in decreased expression of FABP7 mRNA CTD PMID:31881176 Fabp7 Mouse acrylamide decreases expression ISO FABP7 (Homo sapiens) 6480464 Acrylamide results in decreased expression of FABP7 mRNA CTD PMID:32763439 Fabp7 Mouse aflatoxin B1 decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 Aflatoxin B1 results in decreased expression of FABP7 mRNA CTD PMID:33354967 Fabp7 Mouse all-trans-retinoic acid increases expression ISO FABP7 (Homo sapiens) 6480464 Tretinoin results in increased expression of FABP7 mRNA CTD PMID:17045167 Fabp7 Mouse all-trans-retinoic acid decreases expression ISO FABP7 (Homo sapiens) 6480464 Tretinoin results in decreased expression of FABP7 mRNA and Tretinoin results in decreased expression of FABP7 protein CTD PMID:21934132 and PMID:36805303 Fabp7 Mouse all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of FABP7 mRNA CTD PMID:16083855 Fabp7 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 NEUROD2 protein affects the reaction [Tretinoin results in increased expression of FABP7 mRNA] CTD PMID:16083855 Fabp7 Mouse alpha-hexylcinnamaldehyde affects expression EXP 6480464 hexyl cinnamic aldehyde affects the expression of FABP7 mRNA CTD PMID:22302311 Fabp7 Mouse amitrole increases expression ISO Fabp7 (Rattus norvegicus) 6480464 Amitrole results in increased expression of FABP7 mRNA CTD PMID:38685447 Fabp7 Mouse ammonium chloride affects expression ISO Fabp7 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of FABP7 mRNA CTD PMID:16483693 Fabp7 Mouse arsenous acid decreases expression ISO FABP7 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of FABP7 mRNA CTD PMID:26705709 Fabp7 Mouse arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of FABP7 mRNA CTD PMID:35676786 Fabp7 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of FABP7 mRNA CTD PMID:27195522 Fabp7 Mouse benzo[a]pyrene affects methylation ISO FABP7 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of FABP7 promoter CTD PMID:27901495 Fabp7 Mouse benzo[a]pyrene increases methylation ISO FABP7 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of FABP7 5' UTR CTD PMID:27901495 Fabp7 Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of FABP7 mRNA CTD PMID:19850644 and PMID:34319233 Fabp7 Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 PPARA protein inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of FABP7 mRNA] CTD PMID:19850644 Fabp7 Mouse bisphenol A decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of FABP7 mRNA CTD PMID:30816183 more ... Fabp7 Mouse bisphenol A increases expression ISO FABP7 (Homo sapiens) 6480464 bisphenol A results in increased expression of FABP7 protein CTD PMID:37664457 Fabp7 Mouse bisphenol A multiple interactions ISO Fabp7 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FABP7 mRNA CTD PMID:36041667 Fabp7 Mouse bisphenol A decreases expression ISO FABP7 (Homo sapiens) 6480464 bisphenol A results in decreased expression of FABP7 protein CTD PMID:37567409 Fabp7 Mouse bisphenol A affects expression ISO Fabp7 (Rattus norvegicus) 6480464 bisphenol A affects the expression of FABP7 mRNA CTD PMID:30903817 Fabp7 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FABP7 mRNA CTD PMID:30951980 and PMID:32156529 Fabp7 Mouse bisphenol F multiple interactions ISO Fabp7 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FABP7 mRNA CTD PMID:36041667 Fabp7 Mouse Brodifacoum decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 bromfenacoum results in decreased expression of FABP7 protein CTD PMID:28903499 Fabp7 Mouse bromobenzene affects binding ISO Fabp7 (Rattus norvegicus) 6480464 bromobenzene metabolite binds to FABP7 protein CTD PMID:17305373 Fabp7 Mouse bromuconazole decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 bromuconazole results in decreased expression of FABP7 mRNA CTD PMID:33789219 Fabp7 Mouse cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of FABP7 mRNA CTD PMID:18974090 Fabp7 Mouse carbamazepine affects expression ISO FABP7 (Homo sapiens) 6480464 Carbamazepine affects the expression of FABP7 mRNA CTD PMID:25979313 Fabp7 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Fabp7 Mouse chenodeoxycholic acid decreases expression ISO FABP7 (Homo sapiens) 6480464 Chenodeoxycholic Acid results in decreased expression of FABP7 mRNA CTD PMID:27174168 Fabp7 Mouse choline multiple interactions EXP 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of FABP7 mRNA more ... CTD PMID:20938992 more ... Fabp7 Mouse ciguatoxin CTX1B affects expression EXP 6480464 Ciguatoxins affects the expression of FABP7 mRNA CTD PMID:18353800 Fabp7 Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of FABP7 mRNA CTD PMID:27462272 Fabp7 Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of FABP7 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of FABP7 mRNA] CTD PMID:17585979 Fabp7 Mouse clofibrate increases expression ISO Fabp7 (Rattus norvegicus) 6480464 Clofibrate results in increased expression of FABP7 mRNA CTD PMID:33983380 Fabp7 Mouse clofibric acid affects expression ISO Fabp7 (Rattus norvegicus) 6480464 Clofibric Acid affects the expression of FABP7 mRNA CTD PMID:17602206 Fabp7 Mouse corn oil affects expression ISO Fabp7 (Rattus norvegicus) 6480464 Corn Oil affects the expression of FABP7 mRNA CTD PMID:16360708 Fabp7 Mouse corticosterone affects expression ISO Fabp7 (Rattus norvegicus) 6480464 Corticosterone affects the expression of FABP7 mRNA CTD PMID:18363858 Fabp7 Mouse cytarabine increases expression ISO FABP7 (Homo sapiens) 6480464 Cytarabine results in increased expression of FABP7 mRNA CTD PMID:21198554 Fabp7 Mouse diarsenic trioxide decreases expression ISO FABP7 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of FABP7 mRNA CTD PMID:26705709 Fabp7 Mouse diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of FABP7 mRNA CTD PMID:35676786 Fabp7 Mouse diethyl maleate decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 diethyl maleate results in decreased expression of FABP7 mRNA CTD PMID:21161181 Fabp7 Mouse dioxygen increases expression ISO FABP7 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of FABP7 protein CTD PMID:34648812 Fabp7 Mouse dioxygen multiple interactions ISO FABP7 (Homo sapiens) 6480464 [FV-429 compound co-treated with Paclitaxel] inhibits the reaction [Oxygen deficiency results in increased expression of FABP7 protein] and Paclitaxel inhibits the reaction [Oxygen deficiency results in increased expression of FABP7 protein] CTD PMID:34648812 Fabp7 Mouse dorsomorphin multiple interactions ISO FABP7 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fabp7 Mouse doxorubicin multiple interactions EXP 6480464 [[MT1 protein co-treated with MT2 protein] affects the susceptibility to Doxorubicin] which affects the expression of FABP7 mRNA CTD PMID:21040762 Fabp7 Mouse doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of FABP7 mRNA CTD PMID:21040762 Fabp7 Mouse ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of FABP7 mRNA CTD PMID:29018328 Fabp7 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of FABP7 mRNA CTD PMID:30319688 Fabp7 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of FABP7 mRNA CTD PMID:30319688 Fabp7 Mouse ethanol decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 Ethanol results in decreased expression of FABP7 protein CTD PMID:16770775 Fabp7 Mouse flutamide decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of FABP7 mRNA CTD PMID:24136188 Fabp7 Mouse folic acid multiple interactions EXP 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of FABP7 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FABP7 mRNA CTD PMID:20938992 and PMID:29127188 Fabp7 Mouse fonofos increases methylation ISO FABP7 (Homo sapiens) 6480464 Fonofos results in increased methylation of FABP7 promoter CTD PMID:22847954 Fabp7 Mouse furan decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 furan results in decreased expression of FABP7 mRNA CTD PMID:25539665 and PMID:26194646 Fabp7 Mouse glycidyl methacrylate decreases expression ISO FABP7 (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of FABP7 protein CTD PMID:36641056 Fabp7 Mouse indometacin decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 Indomethacin results in decreased expression of FABP7 mRNA CTD PMID:36868495 Fabp7 Mouse isotretinoin decreases expression ISO FABP7 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of FABP7 mRNA CTD PMID:20436886 Fabp7 Mouse L-methionine multiple interactions EXP 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of FABP7 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FABP7 mRNA CTD PMID:20938992 and PMID:29127188 Fabp7 Mouse mercury atom increases expression ISO FABP7 (Homo sapiens) 6480464 Mercury results in increased expression of FABP7 mRNA CTD PMID:16823088 Fabp7 Mouse mercury(0) increases expression ISO FABP7 (Homo sapiens) 6480464 Mercury results in increased expression of FABP7 mRNA CTD PMID:16823088 Fabp7 Mouse metformin increases expression ISO Fabp7 (Rattus norvegicus) 6480464 Metformin results in increased expression of FABP7 mRNA CTD PMID:31324951 Fabp7 Mouse methamphetamine affects expression ISO Fabp7 (Rattus norvegicus) 6480464 Methamphetamine affects the expression of FABP7 protein CTD PMID:17904249 Fabp7 Mouse methapyrilene decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 Methapyrilene results in decreased expression of FABP7 mRNA CTD PMID:30467583 Fabp7 Mouse methimazole increases expression ISO Fabp7 (Rattus norvegicus) 6480464 Methimazole results in increased expression of FABP7 mRNA CTD PMID:38685447 Fabp7 Mouse methylmercury chloride affects expression ISO Fabp7 (Rattus norvegicus) 6480464 methylmercuric chloride affects the expression of FABP7 mRNA CTD PMID:20864626 Fabp7 Mouse methylmercury chloride multiple interactions ISO FABP7 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FABP7 mRNA CTD PMID:27188386 Fabp7 Mouse methylmercury chloride decreases expression ISO FABP7 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of FABP7 mRNA CTD PMID:23179753 more ... Fabp7 Mouse miconazole decreases expression EXP 6480464 Miconazole results in decreased expression of FABP7 mRNA CTD PMID:27462272 Fabp7 Mouse N-nitrosodiethylamine multiple interactions ISO Fabp7 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of FABP7 mRNA CTD PMID:20360939 Fabp7 Mouse N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of FABP7 mRNA CTD PMID:24535843 Fabp7 Mouse N-nitrosodimethylamine decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 Dimethylnitrosamine results in decreased expression of FABP7 mRNA CTD PMID:17072980 and PMID:25380136 Fabp7 Mouse N-nitrosomorpholine affects expression ISO Fabp7 (Rattus norvegicus) 6480464 N-nitrosomorpholine affects the expression of FABP7 mRNA CTD PMID:19716841 Fabp7 Mouse nefazodone decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 nefazodone results in decreased expression of FABP7 mRNA CTD PMID:24136188 Fabp7 Mouse nickel atom decreases expression ISO FABP7 (Homo sapiens) 6480464 Nickel results in decreased expression of FABP7 mRNA CTD PMID:24768652 Fabp7 Mouse nitrofen increases expression ISO Fabp7 (Rattus norvegicus) 6480464 nitrofen results in increased expression of FABP7 mRNA CTD PMID:33484710 Fabp7 Mouse paclitaxel multiple interactions ISO FABP7 (Homo sapiens) 6480464 [FV-429 compound co-treated with Paclitaxel] inhibits the reaction [Oxygen deficiency results in increased expression of FABP7 protein] and Paclitaxel inhibits the reaction [Oxygen deficiency results in increased expression of FABP7 protein] CTD PMID:34648812 Fabp7 Mouse paracetamol multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of FABP7 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of FABP7 mRNA] CTD PMID:17585979 Fabp7 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of FABP7 mRNA CTD PMID:17562736 Fabp7 Mouse parathion increases methylation ISO FABP7 (Homo sapiens) 6480464 Parathion results in increased methylation of FABP7 promoter CTD PMID:22847954 Fabp7 Mouse perfluorohexanesulfonic acid decreases expression EXP 6480464 perfluorohexanesulfonic acid results in decreased expression of FABP7 mRNA CTD PMID:21705711 Fabp7 Mouse perfluorooctane-1-sulfonic acid decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 perfluorooctane sulfonic acid results in decreased expression of FABP7 mRNA CTD PMID:19162173 Fabp7 Mouse perfluorooctanoic acid increases expression ISO Fabp7 (Rattus norvegicus) 6480464 perfluorooctanoic acid results in increased expression of FABP7 protein CTD PMID:34958885 Fabp7 Mouse phenethyl caffeate multiple interactions ISO Fabp7 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of FABP7 mRNA CTD PMID:20360939 Fabp7 Mouse phenylmercury acetate decreases expression ISO FABP7 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of FABP7 mRNA CTD PMID:26272509 Fabp7 Mouse phenylmercury acetate multiple interactions ISO FABP7 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FABP7 mRNA CTD PMID:27188386 Fabp7 Mouse phthalaldehyde affects expression EXP 6480464 o-Phthalaldehyde affects the expression of FABP7 mRNA CTD PMID:22302311 Fabp7 Mouse pirinixic acid increases expression ISO Fabp7 (Rattus norvegicus) 6480464 pirinixic acid results in increased expression of FABP7 mRNA CTD PMID:19162173 and PMID:33983380 Fabp7 Mouse pyrazinecarboxamide decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 Pyrazinamide results in decreased expression of FABP7 mRNA CTD PMID:22431067 Fabp7 Mouse reserpine affects expression ISO Fabp7 (Rattus norvegicus) 6480464 Reserpine affects the expression of FABP7 mRNA CTD PMID:18363858 Fabp7 Mouse resveratrol increases expression ISO FABP7 (Homo sapiens) 6480464 resveratrol results in increased expression of FABP7 mRNA CTD PMID:12002526 Fabp7 Mouse resveratrol multiple interactions ISO FABP7 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of FABP7 mRNA CTD PMID:23557933 Fabp7 Mouse rotenone increases expression ISO Fabp7 (Rattus norvegicus) 6480464 Rotenone results in increased expression of FABP7 mRNA CTD PMID:28374803 Fabp7 Mouse rotenone increases expression EXP 6480464 Rotenone results in increased expression of FABP7 mRNA CTD PMID:32937126 Fabp7 Mouse SB 431542 multiple interactions ISO FABP7 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Fabp7 Mouse sodium arsenite affects methylation ISO FABP7 (Homo sapiens) 6480464 sodium arsenite affects the methylation of FABP7 gene CTD PMID:28589171 Fabp7 Mouse Soman increases expression ISO Fabp7 (Rattus norvegicus) 6480464 Soman results in increased expression of FABP7 mRNA CTD PMID:19281266 Fabp7 Mouse streptozocin multiple interactions EXP 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of FABP7 mRNA CTD PMID:29127188 Fabp7 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of FABP7 mRNA CTD PMID:20937368 Fabp7 Mouse temozolomide increases expression ISO FABP7 (Homo sapiens) 6480464 Temozolomide results in increased expression of FABP7 mRNA CTD PMID:31758290 Fabp7 Mouse terbufos increases methylation ISO FABP7 (Homo sapiens) 6480464 terbufos results in increased methylation of FABP7 promoter CTD PMID:22847954 Fabp7 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of FABP7 mRNA CTD PMID:27339419 and PMID:31919559 Fabp7 Mouse tetracycline decreases expression EXP 6480464 Tetracycline results in decreased expression of FABP7 mRNA CTD PMID:16917069 Fabp7 Mouse thalidomide affects expression EXP 6480464 Thalidomide affects the expression of FABP7 mRNA CTD PMID:26217789 Fabp7 Mouse thimerosal increases expression EXP 6480464 Thimerosal results in increased expression of FABP7 mRNA CTD PMID:24675092 Fabp7 Mouse thioacetamide decreases expression ISO Fabp7 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of FABP7 mRNA CTD PMID:23411599 and PMID:34492290 Fabp7 Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of FABP7 mRNA CTD PMID:23557971 Fabp7 Mouse trichostatin A increases expression ISO FABP7 (Homo sapiens) 6480464 trichostatin A results in increased expression of FABP7 mRNA CTD PMID:24935251 and PMID:26272509 Fabp7 Mouse trichostatin A multiple interactions ISO FABP7 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FABP7 mRNA CTD PMID:27188386 Fabp7 Mouse trimellitic anhydride increases expression EXP 6480464 trimellitic anhydride results in increased expression of FABP7 mRNA CTD PMID:19042947 Fabp7 Mouse trimellitic anhydride affects expression EXP 6480464 trimellitic anhydride affects the expression of FABP7 mRNA CTD PMID:22302311 Fabp7 Mouse triphenyl phosphate affects expression ISO Fabp7 (Rattus norvegicus) 6480464 triphenyl phosphate affects the expression of FABP7 mRNA CTD PMID:30589522 Fabp7 Mouse valproic acid decreases expression ISO FABP7 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of FABP7 mRNA CTD PMID:23179753 Fabp7 Mouse valproic acid increases expression ISO FABP7 (Homo sapiens) 6480464 Valproic Acid results in increased expression of FABP7 mRNA CTD PMID:23179753 more ... Fabp7 Mouse valproic acid multiple interactions ISO FABP7 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FABP7 mRNA CTD PMID:27188386 Fabp7 Mouse valproic acid affects expression ISO FABP7 (Homo sapiens) 6480464 Valproic Acid affects the expression of FABP7 mRNA CTD PMID:25979313 Fabp7 Mouse vancomycin increases expression EXP 6480464 Vancomycin results in increased expression of FABP7 mRNA CTD PMID:18930951 Fabp7 Mouse vorinostat multiple interactions ISO FABP7 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FABP7 mRNA CTD PMID:27188386 Fabp7 Mouse vorinostat increases expression ISO FABP7 (Homo sapiens) 6480464 vorinostat results in increased expression of FABP7 mRNA CTD PMID:26272509 Fabp7 Mouse zinc atom increases expression ISO Fabp7 (Rattus norvegicus) 6480464 Zinc deficiency results in increased expression of FABP7 mRNA CTD PMID:12672911 and PMID:15671213 Fabp7 Mouse zinc(0) increases expression ISO Fabp7 (Rattus norvegicus) 6480464 Zinc deficiency results in increased expression of FABP7 mRNA CTD PMID:12672911 and PMID:15671213
1,1-dichloroethene (EXP) 1-chloro-2,4-dinitrobenzene (EXP) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO) 2,4-dinitrotoluene (EXP) 2-palmitoylglycerol (ISO) 3,3',5,5'-tetrabromobisphenol A (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (ISO) 9-cis-retinoic acid (ISO) acetamide (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) alpha-hexylcinnamaldehyde (EXP) amitrole (ISO) ammonium chloride (ISO) arsenous acid (EXP,ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) Brodifacoum (ISO) bromobenzene (ISO) bromuconazole (ISO) cadmium dichloride (EXP) carbamazepine (ISO) carbon nanotube (EXP) chenodeoxycholic acid (ISO) choline (EXP) ciguatoxin CTX1B (EXP) clobetasol (EXP) clofibrate (EXP,ISO) clofibric acid (ISO) corn oil (ISO) corticosterone (ISO) cytarabine (ISO) diarsenic trioxide (EXP,ISO) diethyl maleate (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (EXP) ethanol (EXP,ISO) flutamide (ISO) folic acid (EXP) fonofos (ISO) furan (ISO) glycidyl methacrylate (ISO) indometacin (ISO) isotretinoin (ISO) L-methionine (EXP) mercury atom (ISO) mercury(0) (ISO) metformin (ISO) methamphetamine (ISO) methapyrilene (ISO) methimazole (ISO) methylmercury chloride (ISO) miconazole (EXP) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (ISO) N-nitrosomorpholine (ISO) nefazodone (ISO) nickel atom (ISO) nitrofen (ISO) paclitaxel (ISO) paracetamol (EXP) parathion (ISO) perfluorohexanesulfonic acid (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenethyl caffeate (ISO) phenylmercury acetate (ISO) phthalaldehyde (EXP) pirinixic acid (ISO) pyrazinecarboxamide (ISO) reserpine (ISO) resveratrol (ISO) rotenone (EXP,ISO) SB 431542 (ISO) sodium arsenite (ISO) Soman (ISO) streptozocin (EXP) tamoxifen (EXP) temozolomide (ISO) terbufos (ISO) tetrachloromethane (EXP) tetracycline (EXP) thalidomide (EXP) thimerosal (EXP) thioacetamide (ISO) titanium dioxide (EXP) trichostatin A (ISO) trimellitic anhydride (EXP) triphenyl phosphate (ISO) valproic acid (ISO) vancomycin (EXP) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Cloning and characterization of a cDNA encoding a novel fatty acid binding protein from rat brain.
Bennett E, etal., J Neurochem 1994 Nov;63(5):1616-24.
2.
Reelin signaling directly affects radial glia morphology and biochemical maturation.
Hartfuss E, etal., Development 2003 Oct;130(19):4597-609.
3.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.
Gene expression profiling reveals molecularly and clinically distinct subtypes of glioblastoma multiforme.
Liang Y, etal., Proc Natl Acad Sci U S A. 2005 Apr 19;102(16):5814-9. Epub 2005 Apr 12.
5.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
6.
MGDs mouse GO annotations
MGD data from the GO Consortium
7.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
8.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Fabp7 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 57,661,019 - 57,664,546 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 57,660,977 - 57,664,546 (+) Ensembl GRCm39 Ensembl GRCm38 10 57,784,923 - 57,788,450 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 57,784,881 - 57,788,450 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 57,504,729 - 57,508,256 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 57,473,336 - 57,476,865 (+) NCBI MGSCv36 mm8 Celera 10 58,602,332 - 58,605,859 (+) NCBI Celera Cytogenetic Map 10 B4 NCBI cM Map 10 29.25 NCBI
FABP7 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 122,749,201 - 122,784,074 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 122,779,716 - 122,784,074 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 123,070,346 - 123,105,219 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 123,142,345 - 123,146,918 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 123,142,344 - 123,146,915 NCBI Celera 6 123,844,958 - 123,849,530 (+) NCBI Celera Cytogenetic Map 6 q22.31 NCBI HuRef 6 120,677,663 - 120,682,239 (+) NCBI HuRef CHM1_1 6 123,364,462 - 123,369,035 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 123,937,487 - 123,972,367 (+) NCBI T2T-CHM13v2.0
Fabp7 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 37,667,125 - 37,673,299 (+) NCBI GRCr8 mRatBN7.2 20 37,123,193 - 37,126,725 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 37,123,193 - 37,126,880 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 38,155,265 - 38,158,796 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 37,545,977 - 37,549,508 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 38,273,007 - 38,276,541 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 40,769,624 - 40,773,156 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 40,769,586 - 40,773,349 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 42,501,163 - 42,504,695 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 36,812,518 - 36,816,050 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 36,826,317 - 36,829,850 (+) NCBI Celera 20 38,435,937 - 38,439,468 (+) NCBI Celera Cytogenetic Map 20 q12 NCBI
Fabp7 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955436 4,642,584 - 4,646,172 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955436 4,642,584 - 4,646,172 (+) NCBI ChiLan1.0 ChiLan1.0
FABP7 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 142,775,902 - 142,780,393 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 140,675,048 - 140,679,541 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 120,539,905 - 120,574,778 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 124,663,054 - 124,697,908 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 124,663,054 - 124,697,905 (+) Ensembl panpan1.1 panPan2
FABP7 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 62,084,372 - 62,088,547 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 61,967,129 - 62,088,547 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 62,894,007 - 62,898,188 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 62,288,652 - 62,292,833 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 62,171,111 - 62,314,381 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 62,222,930 - 62,227,107 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 62,010,994 - 62,015,175 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 62,659,387 - 62,663,563 (+) NCBI UU_Cfam_GSD_1.0
Fabp7 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 112,979,582 - 112,983,528 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936802 1,092,404 - 1,101,672 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936802 1,092,448 - 1,096,293 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FABP7 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 39,871,537 - 39,876,397 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 39,872,198 - 39,876,272 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 44,098,036 - 44,102,111 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FABP7 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 51,021,485 - 51,026,060 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 51,021,501 - 51,026,038 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 23,316,435 - 23,321,039 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fabp7 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 145 Count of miRNA genes: 130 Interacting mature miRNAs: 141 Transcripts: ENSMUST00000020024, ENSMUST00000165013 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300882 Ath17_m atherosclerosis 17 (mouse) Not determined 10 51091490 85091639 Mouse 39128215 Lwq17_m liver weight QTL 17 (mouse) 10 12704051 84079784 Mouse 4141943 W6q6_m weight 6 weeks QTL 6 (mouse) Not determined 12704051 84079784 Mouse 27226772 Tibl13_m tibia length 13, 10 week (mouse) 10 18875748 129635869 Mouse 1357656 Hrtq3_m heart weight QTL 3 (mouse) Not determined 10 12704051 84079784 Mouse 14746991 Manh68_m mandible shape 68 (mouse) 10 52280497 86280497 Mouse 12904011 Cfq11_m conditioned fear QTL 11 (mouse) 10 56480156 60940841 Mouse 26884426 Cvht1_m cranial vault height 1, 5 week (mouse) 10 24675898 121035905 Mouse 10045641 Jckm3_m juvenile cystic kidney modifier 3 (mouse) Not determined 10 49848187 83848412 Mouse 4142380 W3q11_m weight 3 weeks QTL 11 (mouse) Not determined 12704051 84079784 Mouse 27226764 Tibl19_m tibia length 19, 16 week (mouse) 10 39175996 129635869 Mouse 1357825 Kidpq2_m kidney weight percentage QTL 2 (mouse) Not determined 10 12704051 84079784 Mouse 1302150 Bbaa18_m B.burgdorferi-associated arthritis 18 (mouse) Not determined 10 49338012 83338157 Mouse 4142313 Angvq1_m angiogenesis by VEGF QTL 1 (mouse) Not determined 46720403 82491121 Mouse 1301380 Cia8_m collagen induced arthritis QTL 8 (mouse) Not determined 10 51493400 82491121 Mouse 1301003 Lmblgq4_m limb length QTL 4 (mouse) Not determined 10 21591192 68091639 Mouse 4141159 Phl2_m progressive hearing loss 2 (mouse) Not determined 10 47974499 70112651 Mouse 1301386 Sysbp1_m systolic blood pressure 1 (mouse) Not determined 10 10108265 87401095 Mouse 10045632 Heal16_m wound healing/regeneration 16 (mouse) Not determined 10 30974499 64974630 Mouse 1301966 Lifespan2_m life span 2 (mouse) Not determined 10 49848222 83848397 Mouse 1302092 Ath11_m atherosclerosis 11 (mouse) Not determined 10 6151945 58693521 Mouse 26884421 Cvht5_m cranial vault height 5, 10 week (mouse) 10 45576096 69135830 Mouse 1302067 Scc9_m colon tumor susceptibility 9 (mouse) Not determined 10 18259333 125575232 Mouse 26884411 Bzwq8_m bi-zygomatic width QTL 8, 10 week (mouse) 10 44876096 115935905 Mouse 1357558 Bmch4_m bone mechanical trait 4 (mouse) Not determined 10 31577136 65577284 Mouse 1300597 Skull14_m skull morphology 14 (mouse) Not determined 10 49848187 83848412 Mouse 4142169 Pbwg16_m postnatal body weight growth 16 (mouse) Not determined 10 49848187 83848412 Mouse 26884403 Cvht8_m cranial vault height 8, 16 week (mouse) 10 22875899 91035862 Mouse 26884400 Huml5_m humerus length 5, 16 week (mouse) 10 46276096 69235830 Mouse 27095920 Pglq9_m pelvic girdle length QTL 9, 10 week (mouse) 10 33775996 70835830 Mouse 26884407 Bzwq14_m bi-zygomatic width QTL 14, 16 wee (mouse) 10 45476096 120635905 Mouse 1301502 Eae17_m susceptibility to experimental allergic encephalomyelitis 17 (mouse) Not determined 10 51091490 85091639 Mouse 1300898 Cfid_m cystic fibrosis intestinal distress (mouse) Not determined 10 29720403 63720483 Mouse 4141070 Ltgq1_m liver triglyceride QTL 1 (mouse) Not determined 41237326 75237326 Mouse 1558757 Eae34_m experimental allergic encephalomyelitis susceptibility 34 (mouse) Not determined 10 21408154 114217230 Mouse 1357740 Obsty3_m obesity 3 (mouse) Not determined 10 8235478 116190980 Mouse 27095911 Pglq15_m pelvic girdle length QTL 15, 16 week (mouse) 10 39175996 129635869 Mouse 4141956 Egq7_m early growth QTL 7 (mouse) Not determined 12704051 84079784 Mouse 1357864 Scfpq1_m subcutaneous fat pad percentage QTL 1 (mouse) Not determined 10 12704051 84079784 Mouse 1357737 Hpcr2_m hepatocarcinogen resistance 2 (mouse) Not determined 10 49848222 83848397 Mouse 4142272 W10q5_m weight 10 weeks QTL 5 (mouse) Not determined 12704051 84079784 Mouse
U04827
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 10 57,788,258 - 57,788,426 UniSTS GRCm38 MGSCv37 10 57,508,064 - 57,508,232 UniSTS GRCm37 Celera 10 58,605,667 - 58,605,835 UniSTS Cytogenetic Map 10 B4 UniSTS Whitehead_YAC 10 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000020024 ⟹ ENSMUSP00000020024
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 57,660,977 - 57,664,546 (+) Ensembl GRCm38.p6 Ensembl 10 57,784,881 - 57,788,450 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000165013 ⟹ ENSMUSP00000131415
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 57,661,019 - 57,662,908 (+) Ensembl GRCm38.p6 Ensembl 10 57,784,923 - 57,786,812 (+) Ensembl
RefSeq Acc Id:
NM_021272 ⟹ NP_067247
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 10 57,661,019 - 57,664,546 (+) NCBI GRCm38 10 57,784,923 - 57,788,450 (+) ENTREZGENE MGSCv37 10 57,504,729 - 57,508,256 (+) RGD Celera 10 58,602,332 - 58,605,859 (+) RGD cM Map 10 ENTREZGENE
Sequence:
GCAAAGGGTTTTTGTGAATTACGGTGGTGGGTAAGACCCGAGTTCCTCCAGTTCCTGCCTATTTTCAGCTGACTAGGCGGTTAAGGATGGTAGATGCTTTCTGCGCAACCTGGAAGCTGACAGACAGT CAGAATTTTGATGAGTACATGAAAGCTCTGGGCGTGGGCTTTGCCACTAGGCAAGTGGGAAACGTGACCAAACCAACTGTGATTATCAGTCAGGAAGGTGGCAAAGTGGTGATCCGGACACAATGCAC ATTCAAGAACACAGAGATCAATTTCCAGCTGGGAGAAGAGTTTGAAGAAACCAGCATAGATGACAGAAACTGTAAGTCTGTGGTTCGGTTGGATGGAGACAAGCTCATTCATGTGCAGAAGTGGGATG GCAAAGAAACAAATTGTACCAGAGAAATTAAGGATGGCAAGATGGTCGTGACTCTTACCTTTGGGGATATCGTTGCTGTTCGCTGTTATGAAAAGGCATAGAAGAGATGACAGGACTTTTGACAACTT GGTTTCCTGGAGTCCCAGAGTTAGCCAGCTAATGAAGCACTGGTCACTAATTATAAGTTTGTCTTCGGTGTGGAGGTAGAAAATTATAATTCTAAGATGTGTTACTCCAAGCAATTCATGGGATTTTG ATATGCAAATTTACTGTTTTCCATTTTTTTTAAATAATTTTACAATACTTTTTATAGAAATGGGAATATACTTATGACTTTCTTTGGAATGCAAACCAAATTGAAATAAAAAATACACACAC
hide sequence
RefSeq Acc Id:
NP_067247 ⟸ NM_021272
- UniProtKB:
Q4FJK4 (UniProtKB/Swiss-Prot), P51880 (UniProtKB/Swiss-Prot), Q5NDA4 (UniProtKB/TrEMBL)
- Sequence:
MVDAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEINFQLGEEFEETSIDDRNCKSVVRLDGDKLIHVQKWDGKETNCTREIKDGKMVVTLTFGDIVAVRC YEKA
hide sequence
Ensembl Acc Id:
ENSMUSP00000020024 ⟸ ENSMUST00000020024
Ensembl Acc Id:
ENSMUSP00000131415 ⟸ ENSMUST00000165013
RGD ID: 8672004
Promoter ID: EPDNEW_M14033
Type: initiation region
Name: Fabp7_1
Description: Mus musculus fatty acid binding protein 7, brain , mRNA.
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Mouse Assembly Chr Position (strand) Source GRCm38 10 57,784,923 - 57,784,983 EPDNEW