Fabp7 (fatty acid binding protein 7)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fabp7 (fatty acid binding protein 7) Rattus norvegicus

Analyze

Symbol:

Fabp7

Name:

fatty acid binding protein 7

RGD ID:

69312

Description:

Predicted to enable fatty acid binding activity. Involved in epithelial cell proliferation. Predicted to be located in several cellular components, including cell projection; cell-cell junction; and neuronal cell body. Predicted to be active in cytosol and nucleus. Orthologous to human FABP7 (fatty acid binding protein 7); PARTICIPATES IN eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B-FABP; BLBP; brain lipid-binding protein; brain-type fatty acid-binding protein; fatty acid binding protein 7 brain; fatty acid binding protein 7, brain; fatty acid-binding protein 7; fatty acid-binding protein, brain

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FABP7 (fatty acid binding protein 7)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Fabp7 (fatty acid binding protein 7, brain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fabp7 (fatty acid binding protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FABP7 (fatty acid binding protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FABP7 (fatty acid binding protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fabp7 (fatty acid binding protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FABP7 (fatty acid binding protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FABP7 (fatty acid binding protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fabp7 (fatty acid binding protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Fabp7 (fatty acid binding protein 7, brain)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FABP7 (fatty acid binding protein 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fabp7b (fatty acid binding protein 7, brain, b)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fabp7a (fatty acid binding protein 7, brain, a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lbp-5	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lbp-6	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lbp-7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lbp-8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	fabp	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fabp7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	37,123,193 - 37,126,725 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	37,123,193 - 37,126,880 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	38,155,265 - 38,158,796 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	37,545,977 - 37,549,508 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	38,273,007 - 38,276,541 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	40,769,624 - 40,773,156 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	40,769,586 - 40,773,349 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	42,501,163 - 42,504,695 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	36,812,518 - 36,816,050 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	36,826,317 - 36,829,850 (+)	NCBI
Celera	20	38,435,937 - 38,439,468 (+)	NCBI		Celera
Cytogenetic Map	20	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Breast Neoplasms (ISO)

epilepsy (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

glioblastoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO)

2,4-dinitrotoluene (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (EXP)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

9-cis-retinoic acid (ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

alpha-hexylcinnamaldehyde (ISO)

ammonium chloride (EXP)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

Brodifacoum (EXP)

bromobenzene (EXP)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chenodeoxycholic acid (ISO)

choline (ISO)

ciguatoxin CTX1B (ISO)

clobetasol (ISO)

clofibrate (EXP,ISO)

clofibric acid (EXP)

corn oil (EXP)

corticosterone (EXP)

cytarabine (ISO)

diarsenic trioxide (ISO)

diethyl maleate (EXP)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (EXP,ISO)

flutamide (EXP)

folic acid (ISO)

fonofos (ISO)

furan (EXP)

glycidyl methacrylate (ISO)

indometacin (EXP)

isotretinoin (ISO)

L-methionine (ISO)

mercury atom (ISO)

mercury(0) (ISO)

metformin (EXP)

methamphetamine (EXP)

methapyrilene (EXP)

methylmercury chloride (EXP,ISO)

miconazole (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (EXP)

N-nitrosomorpholine (EXP)

nefazodone (EXP)

nickel atom (ISO)

nitrofen (EXP)

paclitaxel (ISO)

paracetamol (ISO)

parathion (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP)

perfluorooctanoic acid (EXP)

phenethyl caffeate (EXP)

phenylmercury acetate (ISO)

phthalaldehyde (ISO)

pirinixic acid (EXP)

pyrazinecarboxamide (EXP)

reserpine (EXP)

resveratrol (ISO)

rotenone (EXP,ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (EXP)

streptozocin (ISO)

tamoxifen (ISO)

temozolomide (ISO)

terbufos (ISO)

tetrachloromethane (ISO)

tetracycline (ISO)

thalidomide (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (EXP)

valproic acid (ISO)

vancomycin (ISO)

vorinostat (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell proliferation in forebrain (ISO)

epithelial cell proliferation (IMP)

fatty acid transport (IBA)

neurogenesis (ISO)

prepulse inhibition (ISO)

startle response (ISO)

Cellular Component

cell periphery (ISO)

cell projection (ISO)

cell-cell junction (ISO)

cytosol (IBA)

neuronal cell body (ISO)

nucleus (IBA)

Molecular Function

fatty acid binding (IBA,TAS)

lipid binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Role of Fabp7, a downstream gene of Pax6, in the maintenance of neuroepithelial cells during early embryonic development of the rat cortex.	Arai Y, etal., J Neurosci. 2005 Oct 19;25(42):9752-61.
2.	Cloning and characterization of a cDNA encoding a novel fatty acid binding protein from rat brain.	Bennett E, etal., J Neurochem 1994 Nov;63(5):1616-24.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Gene expression profiling reveals molecularly and clinically distinct subtypes of glioblastoma multiforme.	Liang Y, etal., Proc Natl Acad Sci U S A. 2005 Apr 19;102(16):5814-9. Epub 2005 Apr 12.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:11133151	PMID:12477932	PMID:12971893	PMID:15965470	PMID:18001149	PMID:23996503	PMID:25433207	PMID:29048614

Genomics

Comparative Map Data

Fabp7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	37,123,193 - 37,126,725 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	37,123,193 - 37,126,880 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	38,155,265 - 38,158,796 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	37,545,977 - 37,549,508 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	38,273,007 - 38,276,541 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	40,769,624 - 40,773,156 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	40,769,586 - 40,773,349 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	42,501,163 - 42,504,695 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	36,812,518 - 36,816,050 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	36,826,317 - 36,829,850 (+)	NCBI
Celera	20	38,435,937 - 38,439,468 (+)	NCBI		Celera
Cytogenetic Map	20	q12	NCBI

FABP7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	122,749,201 - 122,784,074 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	122,779,716 - 122,784,074 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	123,070,346 - 123,105,219 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	123,142,345 - 123,146,918 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	123,142,344 - 123,146,915	NCBI
Celera	6	123,844,958 - 123,849,530 (+)	NCBI		Celera
Cytogenetic Map	6	q22.31	NCBI
HuRef	6	120,677,663 - 120,682,239 (+)	NCBI		HuRef
CHM1_1	6	123,364,462 - 123,369,035 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	123,937,487 - 123,972,367 (+)	NCBI		T2T-CHM13v2.0

Fabp7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	57,661,019 - 57,664,546 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	57,660,977 - 57,664,546 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	57,784,923 - 57,788,450 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	57,784,881 - 57,788,450 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	57,504,729 - 57,508,256 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	57,473,336 - 57,476,865 (+)	NCBI		MGSCv36	mm8
Celera	10	58,602,332 - 58,605,859 (+)	NCBI		Celera
Cytogenetic Map	10	B4	NCBI
cM Map	10	29.25	NCBI

Fabp7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	4,642,584 - 4,646,172 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955436	4,642,584 - 4,646,172 (+)	NCBI	ChiLan1.0	ChiLan1.0

FABP7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	140,675,048 - 140,679,541 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	120,539,905 - 120,574,778 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	124,663,054 - 124,697,908 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	124,663,054 - 124,697,905 (+)	Ensembl	panpan1.1		panPan2

FABP7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	62,084,372 - 62,088,547 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	61,967,129 - 62,088,547 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	62,894,007 - 62,898,188 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	62,288,652 - 62,292,833 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	62,171,111 - 62,314,381 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	62,222,930 - 62,227,107 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	62,010,994 - 62,015,175 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	62,659,387 - 62,663,563 (+)	NCBI		UU_Cfam_GSD_1.0

Fabp7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	112,979,582 - 112,983,528 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936802	1,092,404 - 1,101,672 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936802	1,092,448 - 1,096,293 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FABP7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	39,871,537 - 39,876,397 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	39,872,198 - 39,876,272 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	44,098,036 - 44,102,111 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FABP7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	51,021,485 - 51,026,060 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	51,021,501 - 51,026,038 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	23,316,435 - 23,321,039 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fabp7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624798	8,426,825 - 8,430,939 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624798	8,426,819 - 8,430,949 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fabp7
9 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	99
Count of miRNA genes:	92
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000001079
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
7411652	Foco24	Food consumption QTL 24		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	11757515	54435887	Rat
9590092	Insglur9	Insulin/glucose ratio QTL 9	18.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	20	11757515	54435887	Rat
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	17617832	47606836	Rat
2317880	Alcrsp25	Alcohol response QTL 25	2.3		response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	17697550	54435887	Rat
2303626	Vencon10	Ventilatory control QTL 10		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	20	19190721	54435887	Rat
2303578	Gluco50	Glucose level QTL 50	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	20	25106722	54435887	Rat
2303587	Bw93	Body weight QTL 93	13		body mass (VT:0001259)	body weight (CMO:0000012)	20	25106722	54435887	Rat
2300188	Bmd68	Bone mineral density QTL 68	6.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	20	25106722	54435887	Rat
1331747	Hrtrt16	Heart rate QTL 16	3.163		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	20	25209734	54435887	Rat
1598869	Memor6	Memory QTL 6	3.1		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	20	29244388	54435887	Rat
70158	Bp60	Blood pressure QTL 60	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	31614284	44396023	Rat

Markers in Region

AW529882

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	37,125,271 - 37,125,421 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	40,771,703 - 40,771,852	NCBI	Rnor6.0
Rnor_5.0	20	42,503,242 - 42,503,391	UniSTS	Rnor5.0
RGSC_v3.4	20	36,814,597 - 36,814,746	UniSTS	RGSC3.4
Celera	20	38,438,015 - 38,438,164	UniSTS
RH 3.4 Map	20	397.81	UniSTS
Cytogenetic Map	20	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High			5	5		5			17
Medium			36	36		36			57		4
Low		2	4		2		2	2		15	20	5	2
Below cutoff	2	7	10		16		5	6		10	16	2	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_030832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000325	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U02096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000001079 ⟹ ENSRNOP00000001079

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	37,123,193 - 37,126,725 (+)	Ensembl
Rnor_6.0 Ensembl	20	40,769,586 - 40,773,349 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000117243 ⟹ ENSRNOP00000085320

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	37,123,217 - 37,126,880 (+)	Ensembl

RefSeq Acc Id:

NM_030832 ⟹ NP_110459

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	37,123,193 - 37,126,725 (+)	NCBI
Rnor_6.0	20	40,769,624 - 40,773,156 (+)	NCBI
Rnor_5.0	20	42,501,163 - 42,504,695 (+)	NCBI
RGSC_v3.4	20	36,812,518 - 36,816,050 (+)	RGD
Celera	20	38,435,937 - 38,439,468 (+)	RGD

Sequence:

show sequence

GGAGTTTTGTGAATTACGGTAGTGGGTAAGACCTGAGTTCCTCCAGCTCCTACCTACTTTCAGC
TGACTAGAAGGGCAAGGATGGTAGATGCTTTCTGTGCCACCTGGAAGCTGACAGACAGCCAGAA
TTTTGATGAGTACATGAAGGCTCTGGGCGTGGGCTTTGCCACTAGGCAAGTGGGAAATGTGACC
AAACCAACGGTGATTATCAGTCAGGAAGGCGGCAAAGTGGTGATCCGGACACAATGCACATTCA
AGAACACAGAGATCAGTTTCCAGCTGGGAGAAGAGTTTGAGGAAACAAGCATAGATGACAGGAA
CTGTAAGTCTGTGATTCGGTTGGATGGAGACAAGCTCATTCATGTGCAGAAGTGGGATGGCAAA
GAAACAAATTGTGTCAGAGAAATTAAGGATGGCAAAATGGTTGTGACTCTCACCTTTGGGGATG
TCGTTGCTGTTCGCTGTTATGAAAAGGCATAGAAGAAATGCCGGGTCTTTTGAAAACTTGGTTT
CCTGAAGTTCCAGAGTTATCCAGCTACTGAAGCACTGGTCACTAATTATAAGTTTGTCTTTGGT
GTGGAGGCAGAAAATTATAATTTAAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_110459	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA60455	(Get FASTA)	NCBI Sequence Viewer
	EDL92887	(Get FASTA)	NCBI Sequence Viewer
	EDL92888	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001079
	ENSRNOP00000085320.1
GenBank Protein	P55051	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_110459 ⟸ NM_030832
- UniProtKB:	P55051 (UniProtKB/Swiss-Prot), A6K4D4 (UniProtKB/TrEMBL), A6K4D5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVDAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEIS FQLGEEFEETSIDDRNCKSVIRLDGDKLIHVQKWDGKETNCVREIKDGKMVVTLTFGDVVAVRC YEKA hide sequence

RefSeq Acc Id:

ENSRNOP00000001079 ⟸ ENSRNOT00000001079

RefSeq Acc Id:

ENSRNOP00000085320 ⟸ ENSRNOT00000117243

Protein Domains

Cytosolic fatty-acid binding proteins Lipocalin/cytosolic fatty-acid binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P55051-F1-model_v2	AlphaFold	P55051	1-132	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701637

Promoter ID:

EPDNEW_R12161

Type:

single initiation site

Name:

Fabp7_1

Description:

fatty acid binding protein 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	40,769,621 - 40,769,681	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69312	AgrOrtholog
BioCyc Gene	G2FUF-3581	BioCyc
Ensembl Genes	ENSRNOG00000000814	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001079	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000117243.1	UniProtKB/TrEMBL
Gene3D-CATH	2.40.128.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Calycin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fatty_acid-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ILBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lipocln_cytosolic_FA-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:80841	UniProtKB/Swiss-Prot
NCBI Gene	80841	ENTREZGENE
PANTHER	FATTY ACID-BINDING PROTEIN, BRAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11955	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Lipocalin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fabp7	PhenoGen
PRINTS	FATTYACIDBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	FABP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000814	RatGTEx
Superfamily-SCOP	SSF50814	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC206007
UniProt	A0A8I5ZZU4_RAT	UniProtKB/TrEMBL
	A6K4D4	ENTREZGENE, UniProtKB/TrEMBL
	A6K4D5	ENTREZGENE, UniProtKB/TrEMBL
	FABP7_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-27	Fabp7	fatty acid binding protein 7	Fabp7	fatty acid binding protein 7, brain	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Fabp7	fatty acid binding protein 7, brain		fatty acid binding protein 7	Name updated	1299863	APPROVED
2002-06-10	Fabp7	fatty acid binding protein 7			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expressed in brain and liver	68777
gene_expression	brain mRNA levels are differentially expressed throughout development, peaking at birth and declining to a steady-state at 3 weeks	68777
gene_protein	putative 132 aa protein with predicted size 15 kDa	68777

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)