Advanced Search (OLGA)

Gene: SCG2 (secretogranin II) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

SCG2

Name:

secretogranin II

RGD ID:

734327

HGNC Page

HGNC:10575

Description:

Enables chemoattractant activity and cytokine activity. Involved in several processes, including eosinophil chemotaxis; induction of positive chemotaxis; and negative regulation of apoptotic process. Located in extracellular space.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

CHGC; chromogranin-C; EM66; secretogranin 2; secretogranin-2; secretoneurin; SgII; SN

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Scg2 (secretogranin II)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Scg2 (secretogranin II)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Scg2 (secretogranin II)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	SCG2 (secretogranin II)	NCBI	Ortholog
Canis lupus familiaris (dog):	SCG2 (secretogranin II)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Scg2 (secretogranin II)	NCBI	Ortholog
Sus scrofa (pig):	SCG2 (secretogranin II)	HGNC	EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):	SCG2 (secretogranin II)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Scg2 (secretogranin II)	NCBI	Ortholog
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Scg2 (secretogranin II)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Scg2 (secretogranin II)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	scg2b (secretogranin II (chromogranin C), b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Danio rerio (zebrafish):	scg2a (secretogranin II (chromogranin C) a)	Alliance	DIOPT (ZFIN)
Xenopus laevis (African clawed frog):	scg2.L	Alliance	DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):	scg2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	scg2.S	Alliance	DIOPT (Xenbase)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	223,596,940 - 223,602,361 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	223,596,940 - 223,602,361 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	224,461,658 - 224,467,079 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	224,169,902 - 224,175,365 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	224,287,231 - 224,292,584	NCBI
Celera	2	218,227,485 - 218,232,948 (-)	NCBI		Celera
Cytogenetic Map	2	q36.1	NCBI
HuRef	2	216,313,475 - 216,319,034 (-)	NCBI		HuRef
CHM1_1	2	224,468,089 - 224,473,648 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	224,080,034 - 224,085,455 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SCG2	Human	Neurodevelopmental Disorders		IAGP	RGD:14698285	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SCG2	Human	(S)-amphetamine	decreases expression	ISO	RGD:11259	6480464	Dextroamphetamine results in decreased expression of SCG2 mRNA	CTD	PMID:12558987
SCG2	Human	(S)-nicotine	increases expression	ISO	RGD:3626	6480464	Nicotine results in increased expression of SCG2 mRNA	CTD	PMID:1907749
SCG2	Human	1,2-dimethylhydrazine	increases expression	ISO	RGD:11259	6480464	1,2-Dimethylhydrazine results in increased expression of SCG2 mRNA	CTD	PMID:22206623
SCG2	Human	1,3-dinitrobenzene	decreases expression	ISO	RGD:3626	6480464	3-dinitrobenzene results in decreased expression of SCG2 mRNA	CTD	PMID:21983209
SCG2	Human	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	RGD:3626	6480464	2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of SCG2 mRNA	CTD	PMID:27291303
SCG2	Human	2,2',5,5'-tetrachlorobiphenyl	increases expression	EXP		6480464	2,5,2',5'-tetrachlorobiphenyl results in increased expression of SCG2 mRNA	CTD	PMID:36804509
SCG2	Human	3-isobutyl-1-methyl-7H-xanthine	decreases activity	EXP		6480464	1-Methyl-3-isobutylxanthine results in decreased activity of SCG2 protein alternative form	CTD	PMID:9473216
SCG2	Human	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:3626	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
SCG2	Human	5-aza-2'-deoxycytidine	affects expression	EXP		6480464	Decitabine affects the expression of SCG2 mRNA	CTD	PMID:23300844
SCG2	Human	5-fluorouracil	decreases expression	EXP		6480464	Fluorouracil results in decreased expression of SCG2 protein	CTD	PMID:15352031
SCG2	Human	5-fluorouracil	increases expression	EXP		6480464	Fluorouracil results in increased expression of SCG2 mRNA	CTD	PMID:24737281
SCG2	Human	5-fluorouracil	affects response to substance	EXP		6480464	SCG2 protein affects the susceptibility to Fluorouracil	CTD	PMID:15352031
SCG2	Human	6-propyl-2-thiouracil	decreases expression	ISO	RGD:3626	6480464	Propylthiouracil results in decreased expression of SCG2 mRNA	CTD	PMID:30047161
SCG2	Human	8-Br-cAMP	increases expression	EXP		6480464	8-Bromo Cyclic Adenosine Monophosphate results in increased expression of SCG2 mRNA	CTD	PMID:22079614
SCG2	Human	aflatoxin B1	decreases methylation	EXP		6480464	Aflatoxin B1 results in decreased methylation of SCG2 gene	CTD	PMID:27153756
SCG2	Human	all-trans-retinoic acid	increases expression	EXP		6480464	Tretinoin results in increased expression of SCG2 mRNA	CTD	PMID:23724009
SCG2	Human	allethrin	multiple interactions	ISO	RGD:3626	6480464	[cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in more ...	CTD	PMID:34896426
SCG2	Human	amitrole	decreases expression	ISO	RGD:3626	6480464	Amitrole results in decreased expression of SCG2 mRNA	CTD	PMID:30047161
SCG2	Human	ammonium chloride	affects expression	ISO	RGD:3626	6480464	Ammonium Chloride affects the expression of SCG2 mRNA	CTD	PMID:16483693
SCG2	Human	amphetamine	increases expression	ISO	RGD:3626	6480464	Amphetamine results in increased expression of SCG2 mRNA	CTD	PMID:12638131\|PMID:15033416\|PMID:15592348
SCG2	Human	amphetamine	multiple interactions	ISO	RGD:3626	6480464	Baclofen inhibits the reaction [Amphetamine results in increased expression of SCG2 mRNA]	CTD	PMID:15033416\|PMID:15592348
SCG2	Human	arsenous acid	decreases expression	EXP		6480464	Arsenic Trioxide results in decreased expression of SCG2 mRNA	CTD	PMID:26705709
SCG2	Human	baclofen	multiple interactions	ISO	RGD:3626	6480464	Baclofen inhibits the reaction [Amphetamine results in increased expression of SCG2 mRNA]	CTD	PMID:15033416\|PMID:15592348
SCG2	Human	benzo[a]pyrene	decreases expression	ISO	RGD:11259	6480464	Benzo(a)pyrene results in decreased expression of SCG2 mRNA	CTD	PMID:23735875
SCG2	Human	benzo[a]pyrene	decreases methylation	EXP		6480464	Benzo(a)pyrene results in decreased methylation of SCG2 5' UTR; Benzo(a)pyrene results in decreased methylation of more ...	CTD	PMID:27901495
SCG2	Human	bis(2-chloroethyl) sulfide	increases expression	ISO	RGD:11259	6480464	Mustard Gas results in increased expression of SCG2 mRNA	CTD	PMID:15674843
SCG2	Human	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:11259	6480464	[Streptozocin co-treated with Diethylhexyl Phthalate] results in decreased expression of SCG2 mRNA	CTD	PMID:31606821
SCG2	Human	bisphenol A	decreases expression	ISO	RGD:3626	6480464	bisphenol A results in decreased expression of SCG2 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016\|PMID:34947998
SCG2	Human	bisphenol A	decreases expression	ISO	RGD:11259	6480464	bisphenol A results in decreased expression of SCG2 mRNA	CTD	PMID:32156529
SCG2	Human	bisphenol A	multiple interactions	ISO	RGD:3626	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
SCG2	Human	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of SCG2 gene	CTD	PMID:31601247
SCG2	Human	bisphenol A	increases expression	EXP		6480464	bisphenol A analog results in increased expression of SCG2 mRNA	CTD	PMID:32387340
SCG2	Human	bisphenol F	multiple interactions	ISO	RGD:3626	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
SCG2	Human	cadmium atom	increases expression	EXP		6480464	Cadmium results in increased expression of SCG2 mRNA	CTD	PMID:21694771
SCG2	Human	captan	decreases expression	ISO	RGD:11259	6480464	Captan results in decreased expression of SCG2 mRNA	CTD	PMID:31558096
SCG2	Human	chlordecone	increases expression	ISO	RGD:11259	6480464	Chlordecone results in increased expression of SCG2 mRNA	CTD	PMID:33711761
SCG2	Human	chromium(6+)	multiple interactions	EXP		6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression more ...	CTD	PMID:38479592
SCG2	Human	cisplatin	affects expression	EXP		6480464	Cisplatin affects the expression of SCG2 mRNA	CTD	PMID:23300844
SCG2	Human	cisplatin	multiple interactions	EXP		6480464	Cisplatin promotes the reaction [jinfukang results in decreased expression of SCG2 mRNA]; jinfukang promotes the more ...	CTD	PMID:27392435
SCG2	Human	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of SCG2 mRNA	CTD	PMID:27392435
SCG2	Human	clofibrate	multiple interactions	ISO	RGD:11259	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of SCG2 mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
SCG2	Human	cocaine	increases expression	ISO	RGD:3626	6480464	Cocaine results in increased expression of SCG2 mRNA; Cocaine results in increased expression of SCG2 more ...	CTD	PMID:19918966\|PMID:27899881
SCG2	Human	crocidolite asbestos	decreases expression	ISO	RGD:11259	6480464	Asbestos, Crocidolite results in decreased expression of SCG2 mRNA	CTD	PMID:29279043
SCG2	Human	cyhalothrin	multiple interactions	ISO	RGD:3626	6480464	[cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in more ...	CTD	PMID:34896426
SCG2	Human	cypermethrin	multiple interactions	ISO	RGD:3626	6480464	[cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in more ...	CTD	PMID:34896426
SCG2	Human	DDE	multiple interactions	ISO	RGD:3626	6480464	Dichlorodiphenyl Dichloroethylene inhibits the reaction [Dietary Fats results in increased expression of SCG2 mRNA]	CTD	PMID:28572628
SCG2	Human	decabromodiphenyl ether	multiple interactions	ISO	RGD:3626	6480464	[Flame Retardants co-treated with pentabromodiphenyl ether co-treated with decabromobiphenyl ether co-treated with hexabromocyclododecane] results in more ...	CTD	PMID:32207525
SCG2	Human	dexamethasone	multiple interactions	ISO	RGD:3626	6480464	Dexamethasone inhibits the reaction [Freund's Adjuvant results in increased expression of SCG2 mRNA]	CTD	PMID:21149847
SCG2	Human	diarsenic trioxide	decreases expression	EXP		6480464	Arsenic Trioxide results in decreased expression of SCG2 mRNA	CTD	PMID:26705709
SCG2	Human	dorsomorphin	multiple interactions	EXP		6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
SCG2	Human	doxorubicin	decreases expression	EXP		6480464	Doxorubicin results in decreased expression of SCG2 mRNA	CTD	PMID:29803840
SCG2	Human	fentanyl	affects expression	ISO	RGD:3626	6480464	Fentanyl affects the expression of SCG2 mRNA	CTD	PMID:36032789
SCG2	Human	fenvalerate	multiple interactions	ISO	RGD:3626	6480464	[cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in more ...	CTD	PMID:34896426
SCG2	Human	flavonoids	decreases expression	ISO	RGD:3626	6480464	Flavonoids results in decreased expression of SCG2 mRNA	CTD	PMID:18035473
SCG2	Human	folpet	decreases expression	ISO	RGD:11259	6480464	folpet results in decreased expression of SCG2 mRNA	CTD	PMID:31558096
SCG2	Human	glyphosate	increases expression	ISO	RGD:11259	6480464	Glyphosate results in increased expression of SCG2 mRNA	CTD	PMID:35897073
SCG2	Human	lead(0)	affects expression	EXP		6480464	Lead affects the expression of SCG2 mRNA	CTD	PMID:28903495
SCG2	Human	methamphetamine	increases expression	ISO	RGD:3626	6480464	Methamphetamine results in increased expression of SCG2 mRNA	CTD	PMID:19564919
SCG2	Human	methimazole	decreases expression	ISO	RGD:3626	6480464	Methimazole results in decreased expression of SCG2 mRNA	CTD	PMID:30047161
SCG2	Human	methylparaben	decreases expression	EXP		6480464	methylparaben results in decreased expression of SCG2 mRNA	CTD	PMID:31745603
SCG2	Human	N-methyl-4-phenylpyridinium	decreases expression	ISO	RGD:11259	6480464	1-Methyl-4-phenylpyridinium results in decreased expression of SCG2 protein	CTD	PMID:26558463
SCG2	Human	N-methyl-N-nitrosourea	increases expression	ISO	RGD:3626	6480464	Methylnitrosourea results in increased expression of SCG2 mRNA	CTD	PMID:17412507
SCG2	Human	nickel atom	increases expression	EXP		6480464	Nickel results in increased expression of SCG2 mRNA	CTD	PMID:24768652\|PMID:25583101
SCG2	Human	nickel sulfate	increases expression	EXP		6480464	nickel sulfate results in increased expression of SCG2 mRNA	CTD	PMID:22714537
SCG2	Human	nicotine	increases expression	ISO	RGD:3626	6480464	Nicotine results in increased expression of SCG2 mRNA	CTD	PMID:1907749
SCG2	Human	Oxotremorine	increases expression	ISO	RGD:3626	6480464	Oxotremorine results in increased expression of SCG2 mRNA	CTD	PMID:1907749
SCG2	Human	ozone	multiple interactions	ISO	RGD:11259	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ...	CTD	PMID:34911549
SCG2	Human	paracetamol	multiple interactions	ISO	RGD:11259	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of SCG2 mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
SCG2	Human	paracetamol	increases expression	ISO	RGD:11259	6480464	Acetaminophen results in increased expression of SCG2 mRNA	CTD	PMID:34724096
SCG2	Human	paraquat	affects expression	EXP		6480464	Paraquat affects the expression of SCG2 mRNA; Paraquat affects the expression of SCG2 protein	CTD	PMID:29454966
SCG2	Human	potassium chloride	increases expression	ISO	RGD:3626	6480464	Potassium Chloride results in increased expression of SCG2 mRNA	CTD	PMID:16412482
SCG2	Human	prednisolone	multiple interactions	ISO	RGD:3626	6480464	Prednisolone inhibits the reaction [Freund's Adjuvant results in increased expression of SCG2 mRNA]	CTD	PMID:21149847
SCG2	Human	progesterone	increases expression	ISO	RGD:3626	6480464	Progesterone results in increased expression of SCG2 mRNA	CTD	PMID:16376865
SCG2	Human	propanal	increases expression	EXP		6480464	propionaldehyde results in increased expression of SCG2 mRNA	CTD	PMID:26079696
SCG2	Human	pyrethrins	decreases expression	ISO	RGD:3626	6480464	Pyrethrins results in decreased expression of SCG2 protein	CTD	PMID:34896426
SCG2	Human	reserpine	increases expression	ISO	RGD:3626	6480464	Reserpine results in increased expression of SCG2 mRNA	CTD	PMID:1907749\|PMID:8189248\|PMID:8361347
SCG2	Human	rotenone	increases oxidation	ISO	RGD:3626	6480464	Rotenone results in increased oxidation of SCG2 protein	CTD	PMID:30951809
SCG2	Human	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of SCG2 mRNA	CTD	PMID:29955902
SCG2	Human	Rutecarpine	decreases expression	EXP		6480464	rutecarpine results in decreased expression of SCG2 mRNA	CTD	PMID:34955744
SCG2	Human	SB 431542	multiple interactions	EXP		6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
SCG2	Human	serpentine asbestos	increases expression	EXP		6480464	Asbestos, Serpentine results in increased expression of SCG2 mRNA	CTD	PMID:29523930
SCG2	Human	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of SCG2 mRNA	CTD	PMID:22714537
SCG2	Human	sodium dichromate	decreases expression	ISO	RGD:11259	6480464	sodium bichromate results in decreased expression of SCG2 mRNA	CTD	PMID:31558096
SCG2	Human	Soman	increases expression	ISO	RGD:3626	6480464	Soman results in increased expression of SCG2 mRNA	CTD	PMID:19281266
SCG2	Human	streptozocin	multiple interactions	ISO	RGD:11259	6480464	[Streptozocin co-treated with Diethylhexyl Phthalate] results in decreased expression of SCG2 mRNA	CTD	PMID:31606821
SCG2	Human	streptozocin	increases expression	ISO	RGD:11259	6480464	Streptozocin results in increased expression of SCG2 mRNA	CTD	PMID:31606821
SCG2	Human	sulforaphane	increases expression	ISO	RGD:11259	6480464	sulforaphane results in increased expression of SCG2 mRNA	CTD	PMID:30529165
SCG2	Human	temozolomide	increases expression	EXP		6480464	Temozolomide results in increased expression of SCG2 mRNA	CTD	PMID:31758290
SCG2	Human	thapsigargin	increases expression	EXP		6480464	Thapsigargin results in increased expression of SCG2 mRNA	CTD	PMID:22378314
SCG2	Human	thapsigargin	increases expression	ISO	RGD:3626	6480464	Thapsigargin results in increased expression of SCG2 protein	CTD	PMID:35544339
SCG2	Human	trichostatin A	increases expression	EXP		6480464	trichostatin A results in increased expression of SCG2 mRNA	CTD	PMID:24935251
SCG2	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of SCG2 mRNA	CTD	PMID:25979313
SCG2	Human	valproic acid	multiple interactions	EXP		6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
SCG2	Human	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of SCG2 mRNA	CTD	PMID:26272509
SCG2	Human	wortmannin	decreases activity	EXP		6480464	wortmannin results in decreased activity of SCG2 protein alternative form	CTD	PMID:9473216

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SCG2	Human	angiogenesis	involved_in	IDA		150520179	PMID:14970115	HGNC-UCL	PMID:14970115
SCG2	Human	angiogenesis	involved_in	IBA	MGI:103033\|PANTHER:PTN008558047\|UniProtKB:P13521	150520179		GO_Central	GO_REF:0000033
SCG2	Human	angiogenesis	involved_in	IEA	UniProtKB:Q03517\|ensembl:ENSMUSP00000062556	150520179		Ensembl	GO_REF:0000107
SCG2	Human	endothelial cell migration	involved_in	TAS		150520179	PMID:9473216	HGNC-UCL	PMID:9473216
SCG2	Human	eosinophil chemotaxis	involved_in	IDA		150520179	PMID:9473216	HGNC-UCL	PMID:9473216
SCG2	Human	eosinophil chemotaxis	involved_in	IBA	PANTHER:PTN008558047\|UniProtKB:P13521	150520179		GO_Central	GO_REF:0000033
SCG2	Human	induction of positive chemotaxis	involved_in	IDA		150520179	PMID:9473216	HGNC-UCL	PMID:9473216
SCG2	Human	inflammatory response	involved_in	TAS		150520179	PMID:14970115	HGNC-UCL	PMID:14970115
SCG2	Human	intracellular signal transduction	involved_in	IDA		150520179	PMID:9473216	HGNC-UCL	PMID:9473216
SCG2	Human	MAPK cascade	involved_in	IDA		150520179	PMID:14970115	HGNC-UCL	PMID:14970115
SCG2	Human	negative regulation of endothelial cell apoptotic process	involved_in	IDA		150520179	PMID:14970115	BHF-UCL	PMID:14970115
SCG2	Human	negative regulation of endothelial cell proliferation	involved_in	TAS		150520179	PMID:9473216	HGNC-UCL	PMID:9473216
SCG2	Human	negative regulation of extrinsic apoptotic signaling pathway	involved_in	IDA		150520179	PMID:14970115	BHF-UCL	PMID:14970115
SCG2	Human	positive chemotaxis	involved_in	IDA		150520179	PMID:9473216	BHF-UCL	PMID:9473216
SCG2	Human	positive regulation of endothelial cell proliferation	involved_in	IDA		150520179	PMID:14970115	HGNC-UCL	PMID:14970115
SCG2	Human	protein secretion	involved_in	TAS		150520179	PMID:2745426	PINC	PMID:2745426

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SCG2	Human	dense core granule	located_in	IEA	UniProtKB:Q03517\|ensembl:ENSMUSP00000062556	150520179		Ensembl	GO_REF:0000107
SCG2	Human	endoplasmic reticulum lumen	located_in	TAS		150520179		Reactome	Reactome:R-HSA-8952289
SCG2	Human	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	150520179		UniProt	GO_REF:0000043
SCG2	Human	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	150520179		UniProt	GO_REF:0000044
SCG2	Human	extracellular space	located_in	IDA		150520179	PMID:9473216	HGNC-UCL	PMID:9473216
SCG2	Human	extracellular space	is_active_in	IBA	PANTHER:PTN008558047\|UniProtKB:P13521	150520179		GO_Central	GO_REF:0000033
SCG2	Human	neuronal dense core vesicle	is_active_in	IEA	UniProtKB:Q03517\|ensembl:ENSMUSP00000062556	150520179		Ensembl	GO_REF:0000107
SCG2	Human	secretory granule	located_in	IEA	InterPro:IPR001990	150520179		InterPro	GO_REF:0000002
SCG2	Human	secretory granule	is_active_in	IBA	MGI:103033\|PANTHER:PTN008558047\|RGD:3626	150520179		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SCG2	Human	chemoattractant activity	enables	IDA		150520179	PMID:9473216	HGNC-UCL	PMID:9473216
SCG2	Human	chemoattractant activity	enables	IBA	PANTHER:PTN008558047\|UniProtKB:P13521	150520179		GO_Central	GO_REF:0000033
SCG2	Human	cytokine activity	enables	IBA	PANTHER:PTN008558047\|UniProtKB:P13521	150520179		GO_Central	GO_REF:0000033
SCG2	Human	cytokine activity	enables	IDA		150520179	PMID:14970115	HGNC-UCL	PMID:14970115
SCG2	Human	protein binding	enables	IPI	UniProtKB:Q8WXE1	150520179	PMID:25416956	IntAct	PMID:25416956
SCG2	Human	protein binding	enables	IPI	UniProtKB:Q8WXD2	150520179	PMID:19357184	IntAct	PMID:19357184
SCG2	Human	protein binding	enables	IPI	UniProtKB:Q9UMX0	150520179	PMID:21516116, PMID:32296183	IntAct	PMID:21516116\|PMID:32296183

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1425774	PMID:2053134	PMID:2745426	PMID:8617499	PMID:8825061	PMID:9100282	PMID:9473216	PMID:9654353	PMID:9709974	PMID:10619397	PMID:10648883	PMID:10678772
PMID:11853870	PMID:12477932	PMID:12788858	PMID:14970115	PMID:15489334	PMID:15572199	PMID:15815621	PMID:16101435	PMID:16344560	PMID:16713569	PMID:16807684	PMID:17474147
PMID:17584765	PMID:18239671	PMID:18448176	PMID:18549351	PMID:18721831	PMID:19357184	PMID:20200953	PMID:20550951	PMID:21046454	PMID:21145461	PMID:21516116	PMID:21803620
PMID:21873635	PMID:21988832	PMID:22095909	PMID:22217803	PMID:22655045	PMID:23081990	PMID:23423580	PMID:23918206	PMID:24556756	PMID:24667918	PMID:25307750	PMID:25416956
PMID:26217791	PMID:26378181	PMID:30021884	PMID:30887724	PMID:32296183	PMID:32513696	PMID:33961781	PMID:34160138	PMID:34237211	PMID:34815513	PMID:35341274	PMID:35844556
PMID:35914814	PMID:36215168	PMID:37023080	PMID:37848672	PMID:37933640	PMID:38184555	PMID:38261566	PMID:38334954

SCG2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	223,596,940 - 223,602,361 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	223,596,940 - 223,602,361 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	224,461,658 - 224,467,079 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	224,169,902 - 224,175,365 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	224,287,231 - 224,292,584	NCBI
Celera	2	218,227,485 - 218,232,948 (-)	NCBI		Celera
Cytogenetic Map	2	q36.1	NCBI
HuRef	2	216,313,475 - 216,319,034 (-)	NCBI		HuRef
CHM1_1	2	224,468,089 - 224,473,648 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	224,080,034 - 224,085,455 (-)	NCBI		T2T-CHM13v2.0

Scg2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	79,412,083 - 79,417,743 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	79,412,386 - 79,417,837 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	79,434,366 - 79,440,026 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	79,434,669 - 79,440,120 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	79,431,244 - 79,436,665 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	79,313,693 - 79,319,114 (-)	NCBI		MGSCv36	mm8
MGSCv36	1	80,309,596 - 80,315,017 (-)	NCBI		MGSCv36	mm8
Cytogenetic Map	1	C4	NCBI
cM Map	1	40.89	NCBI

Scg2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	88,251,531 - 88,257,208 (-)	NCBI		GRCr8
mRatBN7.2	9	80,803,074 - 80,808,646 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	80,803,075 - 80,821,097 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	89,232,915 - 89,238,224 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	94,361,806 - 94,367,115 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	92,744,332 - 92,749,641 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	85,237,460 - 85,243,024 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	85,237,458 - 85,243,001 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	84,991,667 - 84,997,231 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	78,762,661 - 78,767,970 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	78,946,079 - 78,951,389 (-)	NCBI
Celera	9	78,291,442 - 78,296,748 (-)	NCBI		Celera
Cytogenetic Map	9	q34	NCBI

Scg2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955453	10,364,607 - 10,366,466 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955453	10,361,440 - 10,366,956 (+)	NCBI	ChiLan1.0	ChiLan1.0

SCG2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	126,223,219 - 126,228,655 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	126,238,188 - 126,243,628 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	110,849,262 - 110,854,770 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	229,427,169 - 229,432,731 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	229,424,536 - 229,429,510 (-)	Ensembl	panpan1.1		panPan2

SCG2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	37	29,435,038 - 29,440,615 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	37	29,435,041 - 29,437,333 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	37	30,270,420 - 30,275,988 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	37	29,459,286 - 29,464,858 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	37	29,459,232 - 29,464,827 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	37	29,370,476 - 29,376,041 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	37	29,304,406 - 29,309,978 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	37	29,314,146 - 29,319,716 (-)	NCBI		UU_Cfam_GSD_1.0

Scg2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	179,024,421 - 179,029,787 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936569	5,367,206 - 5,373,017 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936569	5,367,270 - 5,372,627 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SCG2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	125,419,847 - 125,426,278 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	125,420,773 - 125,426,303 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SCG2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	109,505,344 - 109,510,830 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	89,869,948 - 89,875,489 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Scg2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624823	1,659,431 - 1,661,290 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624823	1,656,195 - 1,661,779 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in SCG2
43 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 2q32.3-37.3(chr2:194898783-236473913)x3	copy number gain	See cases [RCV000051119]	Chr2:194898783..236473913 [GRCh38] Chr2:195763507..237382556 [GRCh37] Chr2:195471752..237047295 [NCBI36] Chr2:2q32.3-37.3	pathogenic
GRCh38/hg38 2q35-36.3(chr2:219081620-225430308)x1	copy number loss	See cases [RCV000052634]	Chr2:219081620..225430308 [GRCh38] Chr2:219946342..226295024 [GRCh37] Chr2:219654586..226003268 [NCBI36] Chr2:2q35-36.3	pathogenic
GRCh38/hg38 2q36.1-36.2(chr2:221387419-224669350)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052635]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052635]\|See cases [RCV000052635]	Chr2:221387419..224669350 [GRCh38] Chr2:222252139..225534067 [GRCh37] Chr2:221960383..225242311 [NCBI36] Chr2:2q36.1-36.2	pathogenic
GRCh38/hg38 2q36.1(chr2:223597428-224061556)x1	copy number loss	See cases [RCV000052636]	Chr2:223597428..224061556 [GRCh38] Chr2:224462146..224926273 [GRCh37] Chr2:224170390..224634517 [NCBI36] Chr2:2q36.1	pathogenic
GRCh38/hg38 2q32.2-37.3(chr2:188818195-242065208)x3	copy number gain	See cases [RCV000052958]	Chr2:188818195..242065208 [GRCh38] Chr2:189682921..243007359 [GRCh37] Chr2:189391166..242656032 [NCBI36] Chr2:2q32.2-37.3	pathogenic
GRCh38/hg38 2q32.2-37.3(chr2:190310736-241892770)x3	copy number gain	See cases [RCV000052959]	Chr2:190310736..241892770 [GRCh38] Chr2:191175462..242834921 [GRCh37] Chr2:190883707..242483594 [NCBI36] Chr2:2q32.2-37.3	pathogenic
GRCh38/hg38 2q32.3-37.3(chr2:193122313-241074980)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052960]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052960]\|See cases [RCV000052960]	Chr2:193122313..241074980 [GRCh38] Chr2:193987039..242014395 [GRCh37] Chr2:193695284..241663068 [NCBI36] Chr2:2q32.3-37.3	pathogenic
GRCh38/hg38 2q34-36.3(chr2:212614422-227121230)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052964]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052964]\|See cases [RCV000052964]	Chr2:212614422..227121230 [GRCh38] Chr2:213479146..227985946 [GRCh37] Chr2:213187391..227694190 [NCBI36] Chr2:2q34-36.3	pathogenic
GRCh38/hg38 2q35-36.3(chr2:219547204-228287942)x4	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052965]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052965]\|See cases [RCV000052965]	Chr2:219547204..228287942 [GRCh38] Chr2:220411926..229152658 [GRCh37] Chr2:220120170..228860902 [NCBI36] Chr2:2q35-36.3	pathogenic
NM_003469.4(SCG2):c.1783G>A (p.Glu595Lys)	single nucleotide variant	Malignant melanoma [RCV000065426]	Chr2:223597500 [GRCh38] Chr2:224462218 [GRCh37] Chr2:224170462 [NCBI36] Chr2:2q36.1	not provided
NM_003469.4(SCG2):c.923C>T (p.Ser308Phe)	single nucleotide variant	Malignant melanoma [RCV000065427]	Chr2:223598360 [GRCh38] Chr2:224463078 [GRCh37] Chr2:224171322 [NCBI36] Chr2:2q36.1	not provided
NM_003469.4(SCG2):c.534C>T (p.Pro178=)	single nucleotide variant	Malignant melanoma [RCV000065428]	Chr2:223598749 [GRCh38] Chr2:224463467 [GRCh37] Chr2:224171711 [NCBI36] Chr2:2q36.1	not provided
GRCh38/hg38 2q36.1-36.2(chr2:221663502-224426183)x1	copy number loss	See cases [RCV000135355]	Chr2:221663502..224426183 [GRCh38] Chr2:222528222..225290900 [GRCh37] Chr2:222236466..224999144 [NCBI36] Chr2:2q36.1-36.2	pathogenic
GRCh38/hg38 2q34-37.3(chr2:210579676-242126245)x3	copy number gain	See cases [RCV000135934]	Chr2:210579676..242126245 [GRCh38] Chr2:211444400..243059659 [GRCh37] Chr2:211152645..242717069 [NCBI36] Chr2:2q34-37.3	pathogenic
GRCh38/hg38 2q31.3-36.2(chr2:180513793-224302848)x3	copy number gain	See cases [RCV000139446]	Chr2:180513793..224302848 [GRCh38] Chr2:181378520..225167565 [GRCh37] Chr2:181086765..224875809 [NCBI36] Chr2:2q31.3-36.2	pathogenic
GRCh38/hg38 2q32.2-37.3(chr2:189436149-241841232)x3	copy number gain	See cases [RCV000142307]	Chr2:189436149..241841232 [GRCh38] Chr2:190300875..242783384 [GRCh37] Chr2:190009120..242432057 [NCBI36] Chr2:2q32.2-37.3	pathogenic
GRCh38/hg38 2q35-37.3(chr2:218101759-242126245)x3	copy number gain	See cases [RCV000143216]	Chr2:218101759..242126245 [GRCh38] Chr2:218966482..243059659 [GRCh37] Chr2:218674727..242717069 [NCBI36] Chr2:2q35-37.3	pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:14238-243048760)x3	copy number gain	not provided [RCV000752802]	Chr2:14238..243048760 [GRCh37] Chr2:2p25.3-q37.3	pathogenic
GRCh37/hg19 2q35-37.3(chr2:219966808-237815985)x3	copy number gain	See cases [RCV000448049]	Chr2:219966808..237815985 [GRCh37] Chr2:2q35-37.3	pathogenic
GRCh37/hg19 2q36.1-37.1(chr2:223378640-232061074)x1	copy number loss	See cases [RCV000448773]	Chr2:223378640..232061074 [GRCh37] Chr2:2q36.1-37.1	likely pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:12771-242783384)	copy number gain	See cases [RCV000512056]	Chr2:12771..242783384 [GRCh37] Chr2:2p25.3-q37.3	pathogenic
GRCh37/hg19 2q34-37.3(chr2:213518431-242783384)x3	copy number gain	See cases [RCV000512009]	Chr2:213518431..242783384 [GRCh37] Chr2:2q34-37.3	pathogenic
GRCh37/hg19 2q36.1-37.3(chr2:222077224-239394441)x3	copy number gain	See cases [RCV000511816]	Chr2:222077224..239394441 [GRCh37] Chr2:2q36.1-37.3	pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:12771-242783384)x3	copy number gain	See cases [RCV000511212]	Chr2:12771..242783384 [GRCh37] Chr2:2p25.3-q37.3	pathogenic
GRCh37/hg19 2q35-36.3(chr2:217374144-227643620)x1	copy number loss	not provided [RCV000585275]	Chr2:217374144..227643620 [GRCh37] Chr2:2q35-36.3	likely pathogenic
GRCh37/hg19 2q35-36.3(chr2:221439250-226170404)x1	copy number loss	not provided [RCV000682155]	Chr2:221439250..226170404 [GRCh37] Chr2:2q35-36.3	pathogenic
GRCh37/hg19 2q35-36.2(chr2:220614743-225587770)x1	copy number loss	not provided [RCV000682158]	Chr2:220614743..225587770 [GRCh37] Chr2:2q35-36.2	pathogenic
GRCh37/hg19 2q35-37.3(chr2:219225872-242016876)x3	copy number gain	not provided [RCV000682170]	Chr2:219225872..242016876 [GRCh37] Chr2:2q35-37.3	pathogenic
GRCh37/hg19 2q35-36.3(chr2:218813434-227450699)x1	copy number loss	not provided [RCV000682163]	Chr2:218813434..227450699 [GRCh37] Chr2:2q35-36.3	pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:15672-243101834)x3	copy number gain	not provided [RCV000752804]	Chr2:15672..243101834 [GRCh37] Chr2:2p25.3-q37.3	pathogenic
Single allele	duplication	Neurodevelopmental disorder [RCV000787403]	Chr2:188926928..225298653 [GRCh37] Chr2:2q32.1-36.2	pathogenic
NM_003469.5(SCG2):c.1794C>T (p.Asn598=)	single nucleotide variant	not provided [RCV000964723]	Chr2:223597489 [GRCh38] Chr2:224462207 [GRCh37] Chr2:2q36.1	benign
NM_003469.5(SCG2):c.791A>G (p.Glu264Gly)	single nucleotide variant	not specified [RCV004302254]	Chr2:223598492 [GRCh38] Chr2:224463210 [GRCh37] Chr2:2q36.1	uncertain significance
GRCh37/hg19 2q34-37.3(chr2:210779657-239879183)x3	copy number gain	See cases [RCV000790568]	Chr2:210779657..239879183 [GRCh37] Chr2:2q34-37.3	pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:1-243199373)	copy number gain	Mosaic trisomy 2 [RCV002280628]	Chr2:1..243199373 [GRCh37] Chr2:2p25.3-q37.3	pathogenic
GRCh37/hg19 2q31.2-37.3(chr2:178397959-243007457)x3	copy number gain	See cases [RCV001263052]	Chr2:178397959..243007457 [GRCh37] Chr2:2q31.2-37.3	pathogenic
GRCh37/hg19 2q36.1(chr2:222621434-224754689)x1	copy number loss	not provided [RCV001259185]	Chr2:222621434..224754689 [GRCh37] Chr2:2q36.1	pathogenic
GRCh37/hg19 2q35-36.3(chr2:220056891-227164817)x1	copy number loss	not provided [RCV001537914]	Chr2:220056891..227164817 [GRCh37] Chr2:2q35-36.3	pathogenic
NM_003469.5(SCG2):c.1282C>A (p.Pro428Thr)	single nucleotide variant	not specified [RCV004300899]	Chr2:223598001 [GRCh38] Chr2:224462719 [GRCh37] Chr2:2q36.1	uncertain significance
GRCh37/hg19 2q35-37.3(chr2:219606537-239217703)	copy number loss	not specified [RCV002053285]	Chr2:219606537..239217703 [GRCh37] Chr2:2q35-37.3	pathogenic
GRCh37/hg19 2q36.1-37.1(chr2:223378640-232061074)	copy number loss	not specified [RCV002053287]	Chr2:223378640..232061074 [GRCh37] Chr2:2q36.1-37.1	pathogenic
GRCh37/hg19 2q36.1-36.2(chr2:222902251-226084516)	copy number loss	Waardenburg syndrome type 1 [RCV002280673]	Chr2:222902251..226084516 [GRCh37] Chr2:2q36.1-36.2	pathogenic
NM_003469.5(SCG2):c.947G>C (p.Arg316Thr)	single nucleotide variant	not specified [RCV004193225]	Chr2:223598336 [GRCh38] Chr2:224463054 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1514G>T (p.Gly505Val)	single nucleotide variant	not specified [RCV004110908]	Chr2:223597769 [GRCh38] Chr2:224462487 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.372G>T (p.Glu124Asp)	single nucleotide variant	not specified [RCV004225044]	Chr2:223598911 [GRCh38] Chr2:224463629 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1391C>T (p.Pro464Leu)	single nucleotide variant	not specified [RCV004208635]	Chr2:223597892 [GRCh38] Chr2:224462610 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1670A>T (p.Gln557Leu)	single nucleotide variant	not specified [RCV004202417]	Chr2:223597613 [GRCh38] Chr2:224462331 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1249A>G (p.Lys417Glu)	single nucleotide variant	not specified [RCV004154052]	Chr2:223598034 [GRCh38] Chr2:224462752 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.706G>A (p.Ala236Thr)	single nucleotide variant	not specified [RCV004123175]	Chr2:223598577 [GRCh38] Chr2:224463295 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.810G>T (p.Glu270Asp)	single nucleotide variant	not specified [RCV004202625]	Chr2:223598473 [GRCh38] Chr2:224463191 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.24G>T (p.Trp8Cys)	single nucleotide variant	not specified [RCV004180035]	Chr2:223599259 [GRCh38] Chr2:224463977 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.143A>G (p.Gln48Arg)	single nucleotide variant	not specified [RCV004069886]	Chr2:223599140 [GRCh38] Chr2:224463858 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.93G>C (p.Gln31His)	single nucleotide variant	not specified [RCV004160876]	Chr2:223599190 [GRCh38] Chr2:224463908 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1112C>T (p.Thr371Ile)	single nucleotide variant	not specified [RCV004084307]	Chr2:223598171 [GRCh38] Chr2:224462889 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1470A>T (p.Arg490Ser)	single nucleotide variant	not specified [RCV004222000]	Chr2:223597813 [GRCh38] Chr2:224462531 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.657G>T (p.Met219Ile)	single nucleotide variant	not specified [RCV004221903]	Chr2:223598626 [GRCh38] Chr2:224463344 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.322G>C (p.Glu108Gln)	single nucleotide variant	not specified [RCV004267872]	Chr2:223598961 [GRCh38] Chr2:224463679 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1220A>G (p.Asn407Ser)	single nucleotide variant	not specified [RCV004351703]	Chr2:223598063 [GRCh38] Chr2:224462781 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.932T>A (p.Ile311Asn)	single nucleotide variant	not specified [RCV004336101]	Chr2:223598351 [GRCh38] Chr2:224463069 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.407C>T (p.Ala136Val)	single nucleotide variant	not specified [RCV004356138]	Chr2:223598876 [GRCh38] Chr2:224463594 [GRCh37] Chr2:2q36.1	uncertain significance
GRCh37/hg19 2q35-37.3(chr2:218376403-242783384)x3	copy number gain	not provided [RCV003484087]	Chr2:218376403..242783384 [GRCh37] Chr2:2q35-37.3	pathogenic
GRCh37/hg19 2q35-37.3(chr2:216815496-242782258)x3	copy number gain	See cases [RCV004442836]	Chr2:216815496..242782258 [GRCh37] Chr2:2q35-37.3	pathogenic
NM_003469.5(SCG2):c.1054A>G (p.Ile352Val)	single nucleotide variant	not specified [RCV004452777]	Chr2:223598229 [GRCh38] Chr2:224462947 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1147C>T (p.Arg383Trp)	single nucleotide variant	not specified [RCV004452779]	Chr2:223598136 [GRCh38] Chr2:224462854 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1639A>G (p.Ile547Val)	single nucleotide variant	not specified [RCV004452782]	Chr2:223597644 [GRCh38] Chr2:224462362 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.934G>T (p.Ala312Ser)	single nucleotide variant	not specified [RCV004452785]	Chr2:223598349 [GRCh38] Chr2:224463067 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1730A>G (p.Asp577Gly)	single nucleotide variant	not specified [RCV004452783]	Chr2:223597553 [GRCh38] Chr2:224462271 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1495G>A (p.Asp499Asn)	single nucleotide variant	not specified [RCV004452781]	Chr2:223597788 [GRCh38] Chr2:224462506 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1098T>G (p.Ile366Met)	single nucleotide variant	not specified [RCV004452778]	Chr2:223598185 [GRCh38] Chr2:224462903 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1179C>G (p.Asp393Glu)	single nucleotide variant	not specified [RCV004452780]	Chr2:223598104 [GRCh38] Chr2:224462822 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.467G>T (p.Trp156Leu)	single nucleotide variant	not specified [RCV004452784]	Chr2:223598816 [GRCh38] Chr2:224463534 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1624C>A (p.Gln542Lys)	single nucleotide variant	not specified [RCV004658691]	Chr2:223597659 [GRCh38] Chr2:224462377 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.396T>G (p.Asn132Lys)	single nucleotide variant	not specified [RCV004658692]	Chr2:223598887 [GRCh38] Chr2:224463605 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.978A>C (p.Leu326Phe)	single nucleotide variant	not specified [RCV004658690]	Chr2:223598305 [GRCh38] Chr2:224463023 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1331G>A (p.Ser444Asn)	single nucleotide variant	not specified [RCV004674559]	Chr2:223597952 [GRCh38] Chr2:224462670 [GRCh37] Chr2:2q36.1	likely benign
NM_003469.5(SCG2):c.1352C>T (p.Ser451Leu)	single nucleotide variant	not specified [RCV004858860]	Chr2:223597931 [GRCh38] Chr2:224462649 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.166A>G (p.Ile56Val)	single nucleotide variant	not specified [RCV004858861]	Chr2:223599117 [GRCh38] Chr2:224463835 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1448G>C (p.Trp483Ser)	single nucleotide variant	not specified [RCV004858857]	Chr2:223597835 [GRCh38] Chr2:224462553 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.1262G>A (p.Arg421His)	single nucleotide variant	not specified [RCV004858858]	Chr2:223598021 [GRCh38] Chr2:224462739 [GRCh37] Chr2:2q36.1	likely benign
NM_003469.5(SCG2):c.443G>A (p.Ser148Asn)	single nucleotide variant	not specified [RCV004858862]	Chr2:223598840 [GRCh38] Chr2:224463558 [GRCh37] Chr2:2q36.1	uncertain significance
NM_003469.5(SCG2):c.646C>T (p.Arg216Cys)	single nucleotide variant	not specified [RCV004858859]	Chr2:223598637 [GRCh38] Chr2:224463355 [GRCh37] Chr2:2q36.1	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	453
Count of miRNA genes:	313
Interacting mature miRNAs:	325
Transcripts:	ENST00000305409, ENST00000421386, ENST00000433889
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293458	PRSTS291_H	Prostate tumor susceptibility QTL 291 (human)		0.012	Prostate tumor susceptibility		2	200715236	226715236	Human
1643053	BW117_H	Body Weight QTL 117 (human)	2.4	0.00044	Body weight		2	200715236	226715236	Human
2289332	BW376_H	Body weight QTL 376 (human)	1.87	0.00168	Body fat amount	abdominal	2	213765566	239765566	Human
1643254	BW125_H	Body Weight QTL 125 (human)	1.45	0.005	Body weight	body mass index	2	200715236	226715236	Human

SCG2_390

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	2	224,461,638 - 224,462,470	UniSTS	GRCh37
Build 36	2	224,169,882 - 224,170,714	RGD	NCBI36
Celera	2	218,227,465 - 218,228,297	RGD
HuRef	2	216,313,455 - 216,314,287	UniSTS

SCG2

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	2	224,461,899 - 224,461,999	UniSTS	GRCh37
GRCh37	2	224,462,487 - 224,463,097	UniSTS	GRCh37
Build 36	2	224,170,143 - 224,170,243	RGD	NCBI36
Celera	2	218,228,314 - 218,228,924	UniSTS
Celera	2	218,227,726 - 218,227,826	RGD
HuRef	2	216,313,716 - 216,313,816	UniSTS
HuRef	2	216,314,304 - 216,314,914	UniSTS

RH17683

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	2	224,461,857 - 224,462,012	UniSTS	GRCh37
Build 36	2	224,170,101 - 224,170,256	RGD	NCBI36
Celera	2	218,227,684 - 218,227,839	RGD
Cytogenetic Map	2	q35-q36	UniSTS
HuRef	2	216,313,674 - 216,313,829	UniSTS
GeneMap99-GB4 RH Map	2	697.35	UniSTS

SHGC-12518

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	2	224,461,753 - 224,462,097	UniSTS	GRCh37
Build 36	2	224,169,997 - 224,170,341	RGD	NCBI36
Celera	2	218,227,580 - 218,227,924	RGD
Cytogenetic Map	2	q35-q36	UniSTS
HuRef	2	216,313,570 - 216,313,914	UniSTS
TNG Radiation Hybrid Map	2	124083.0	UniSTS
Stanford-G3 RH Map	2	8728.0	UniSTS
GeneMap99-G3 RH Map	2	9567.0	UniSTS

RH35885

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	2	224,461,848 - 224,462,018	UniSTS	GRCh37
Build 36	2	224,170,092 - 224,170,262	RGD	NCBI36
Celera	2	218,227,675 - 218,227,845	RGD
Cytogenetic Map	2	q35-q36	UniSTS
HuRef	2	216,313,665 - 216,313,835	UniSTS
GeneMap99-GB4 RH Map	2	697.35	UniSTS
NCBI RH Map	2	1825.7	UniSTS

SCG2

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	2	224,461,899 - 224,461,999	UniSTS	GRCh37
GRCh37	2	224,462,487 - 224,463,097	UniSTS	GRCh37
Build 36	2	224,170,143 - 224,170,243	RGD	NCBI36
Celera	2	218,228,314 - 218,228,924	UniSTS
Celera	2	218,227,726 - 218,227,826	RGD
HuRef	2	216,313,716 - 216,313,816	UniSTS
HuRef	2	216,314,304 - 216,314,914	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
1202	2419	2739	2217	4939	1597	2219	4	499	1636	342	2256	6764	6116	50	3721	840	1719	1608	169


RefSeq Transcripts	NG_027998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_003469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC012512	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF106540	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF145702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK298828	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK312452	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC022509	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068276	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DA271642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M25756	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000305409 ⟹ ENSP00000304133

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	223,596,940 - 223,602,361 (-)	Ensembl

Ensembl Acc Id:

ENST00000421386 ⟹ ENSP00000394702

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	223,598,851 - 223,602,284 (-)	Ensembl

Ensembl Acc Id:

ENST00000433889 ⟹ ENSP00000415468

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	223,598,906 - 223,602,361 (-)	Ensembl

RefSeq Acc Id:

NM_003469 ⟹ NP_003460

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	2	223,596,940 - 223,602,361 (-)	NCBI
GRCh37	2	224,461,658 - 224,467,217 (-)	ENTREZGENE
Build 36	2	224,169,902 - 224,175,365 (-)	NCBI Archive
HuRef	2	216,313,475 - 216,319,034 (-)	ENTREZGENE
CHM1_1	2	224,468,089 - 224,473,648 (-)	NCBI
T2T-CHM13v2.0	2	224,080,034 - 224,085,455 (-)	NCBI

Sequence:

show sequence

GAAACGGCCCGAGAAGCTCGCCCGGAGAACGGGGAGGAATATGCTGTGGAGCTCCTCTGCCATATAAACAAAAAGAGGAAATCTTTCAAACATGGCTGAAGCAAAGACCCACTGGCTTGGAGCAGCCC
TGTCTCTTATCCCTTTAATTTTCCTCATCTCTGGGGCTGAAGCAGCTTCATTTCAGAGAAACCAGCTGCTTCAGAAAGAACCAGACCTCAGGTTGGAAAATGTCCAAAAGTTTCCCAGTCCTGAAATG
ATCAGGGCTTTGGAGTACATAGAAAACCTCCGACAACAAGCTCATAAGGAAGAAAGCAGCCCAGATTATAATCCCTACCAAGGTGTCTCTGTCCCCCTTCAGCAAAAAGAAAATGGCGATGAAAGCCA
CTTGCCCGAGAGGGATTCACTGAGTGAAGAAGACTGGATGAGAATAATACTCGAAGCTTTGAGACAGGCTGAAAATGAGCCTCAGTCTGCACCAAAAGAAAATAAGCCCTATGCCTTGAATTCAGAAA
AGAACTTTCCAATGGACATGAGTGATGATTATGAGACACAGCAGTGGCCAGAAAGAAAGCTTAAGCACATGCAATTCCCTCCTATGTATGAAGAGAATTCCAGGGATAACCCCTTTAAACGCACAAAT
GAAATAGTGGAGGAACAATATACTCCTCAAAGCCTTGCTACATTGGAATCTGTCTTCCAAGAGCTGGGGAAACTGACAGGACCAAACAACCAGAAACGTGAGAGGATGGATGAGGAGCAAAAACTTTA
TACGGATGATGAAGATGATATCTACAAGGCTAATAACATTGCCTATGAAGATGTGGTCGGGGGAGAAGACTGGAACCCAGTAGAGGAGAAAATAGAGAGTCAAACCCAGGAAGAGGTGAGAGACAGCA
AAGAGAATATAGAAAAAAATGAACAAATCAACGATGAGATGAAACGCTCAGGGCAGCTTGGCATCCAGGAAGAAGATCTTCGGAAAGAGAGTAAAGACCAACTCTCAGATGATGTCTCCAAAGTAATT
GCCTATTTGAAAAGGTTAGTAAATGCTGCAGGAAGTGGGAGGTTACAGAATGGGCAAAATGGGGAAAGGGCCACCAGGCTTTTTGAGAAACCTCTTGATTCTCAGTCTATTTATCAGCTGATTGAAAT
CTCAAGGAATTTACAGATACCCCCAGAAGACTTAATTGAGATGCTCAAAACTGGGGAGAAGCCGAATGGATCAGTGGAACCGGAGCGGGAGCTTGACCTTCCTGTTGACCTAGATGACATCTCAGAGG
CTGACTTAGACCATCCAGACCTGTTCCAAAATAGGATGCTCTCCAAGAGTGGCTACCCTAAAACACCTGGTCGTGCTGGGACTGAGGCCCTACCAGACGGGCTCAGTGTTGAGGATATTTTAAATCTT
TTAGGGATGGAGAGTGCAGCAAATCAGAAAACGTCGTATTTTCCCAATCCATATAACCAGGAGAAAGTTCTGCCAAGGCTCCCTTATGGTGCTGGAAGATCTAGATCGAACCAGCTTCCCAAAGCTGC
CTGGATTCCACATGTTGAAAACAGACAGATGGCATATGAAAACCTGAACGACAAGGATCAAGAATTAGGTGAGTACTTGGCCAGGATGCTAGTTAAATACCCTGAGATCATTAATTCAAACCAAGTGA
AGCGAGTTCCTGGTCAAGGCTCATCTGAAGATGACCTGCAGGAAGAGGAACAAATTGAGCAGGCCATCAAAGAGCATTTGAATCAAGGCAGCTCTCAGGAGACTGACAAGCTGGCCCCGGTGAGCAAA
AGGTTCCCTGTGGGGCCCCCGAAGAATGATGATACCCCAAATAGGCAGTACTGGGATGAAGATCTGTTAATGAAAGTGCTGGAATACCTCAACCAAGAAAAGGCAGAAAAGGGAAGGGAGCATATTGC
TAAGAGAGCAATGGAAAATATGTAAGCTGCTTTCATTAATTACCCTACTTTCATTCCTCCCACCCCAAGCAAATCCCAACATTTCTCTTCAGTGTGTTGACTTCTATCCTGTTAACACTGTAATATCT
TTAAATGATGTACAGGCAGATGAAACCAGGTCACTGGGGAGTCTGCTTCATTTCCTCTGAGCTGTTATCTTGTGTATGGATATGTGTAAATGTTATGACTCCTTGATAAAAAATTTATTATGTCCATT
ATTCAAGAAAGATATCTATGACTGTGTTTAATAGTATATCTAATGGCTGTGGCATTGTTGATGCTCACATATGATAAAAAAGTGTCCTATAATTCTATTGAAAGTTTTTAATATTTATTGAATTATTT
TGTTACTGTCTGTAGTGTTTTGTGGAGTACTGGACCAAAAAAATAAAGCATTATAAATATATAGTTTTATTTATAAGGCCTTTTCTATTGTGTGTTTTACTGTTGATTAATAAATGTTATTTCTGGAC
AA

hide sequence


Protein RefSeqs	NP_003460	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA36607	(Get FASTA)	NCBI Sequence Viewer
	AAH22509	(Get FASTA)	NCBI Sequence Viewer
	AAY24243	(Get FASTA)	NCBI Sequence Viewer
	BAG35359	(Get FASTA)	NCBI Sequence Viewer
	BAG60958	(Get FASTA)	NCBI Sequence Viewer
	EAW70811	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000304133
	ENSP00000304133.2
GenBank Protein	P13521	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_003460 ⟸ NM_003469
- Peptide Label:	precursor
- UniProtKB:	Q53T11 (UniProtKB/Swiss-Prot), B2R662 (UniProtKB/Swiss-Prot), Q8TBH3 (UniProtKB/Swiss-Prot), P13521 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAEAKTHWLGAALSLIPLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIENLRQQAHKEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQAENEPQSA PKENKPYALNSEKNFPMDMSDDYETQQWPERKLKHMQFPPMYEENSRDNPFKRTNEIVEEQYTPQSLATLESVFQELGKLTGPNNQKRERMDEEQKLYTDDEDDIYKANNIAYEDVVGGEDWNPVEEK IESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQLIEISRNLQIPPEDLIEMLKTGEKPNGSVEPERE LDLPVDLDDISEADLDHPDLFQNRMLSKSGYPKTPGRAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARML VKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM hide sequence

Ensembl Acc Id:

ENSP00000415468 ⟸ ENST00000433889

Ensembl Acc Id:

ENSP00000394702 ⟸ ENST00000421386

Ensembl Acc Id:

ENSP00000304133 ⟸ ENST00000305409

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P13521-F1-model_v2	AlphaFold	P13521	1-617	view protein structure

RGD ID:

6862956

Promoter ID:

EPDNEW_H4643

Type:

initiation region

Name:

SCG2_1

Description:

secretogranin II

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	2	223,602,360 - 223,602,420	EPDNEW

Database	Acc Id	Source(s)
COSMIC	SCG2	COSMIC
Ensembl Genes	ENSG00000171951	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000305409	ENTREZGENE
	ENST00000305409.3	UniProtKB/Swiss-Prot
GTEx	ENSG00000171951	GTEx
HGNC ID	HGNC:10575	ENTREZGENE
Human Proteome Map	SCG2	Human Proteome Map
InterPro	Chromogranin_CS	UniProtKB/Swiss-Prot
	Granin	UniProtKB/Swiss-Prot
	ScgII	UniProtKB/Swiss-Prot
KEGG Report	hsa:7857	UniProtKB/Swiss-Prot
NCBI Gene	7857	ENTREZGENE
OMIM	118930	OMIM
PANTHER	PTHR15119	UniProtKB/Swiss-Prot
	SECRETOGRANIN-2	UniProtKB/Swiss-Prot
Pfam	Granin	UniProtKB/Swiss-Prot
PharmGKB	PA34987	PharmGKB
PROSITE	GRANINS_1	UniProtKB/Swiss-Prot
UniProt	B2R662	ENTREZGENE
	C9JDT0_HUMAN	UniProtKB/TrEMBL
	C9JQI2_HUMAN	UniProtKB/TrEMBL
	P13521	ENTREZGENE
	Q53T11	ENTREZGENE
	Q8TBH3	ENTREZGENE
	SCG2_HUMAN	UniProtKB/Swiss-Prot
UniProt Secondary	B2R662	UniProtKB/Swiss-Prot
	Q53T11	UniProtKB/Swiss-Prot
	Q8TBH3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-07-27	SCG2	secretogranin II	SCG2	secretogranin II (chromogranin C)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar