Symbol:
Usp15
Name:
ubiquitin specific peptidase 15
RGD ID:
733297
MGI Page
MGI
Description:
Enables cysteine-type deubiquitinase activity. Involved in protein deubiquitination. Acts upstream of or within regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator. Predicted to be located in cytosol and nuclear body. Predicted to be active in nucleus. Is expressed in incisor; nasal cavity epithelium; nervous system; submandibular gland primordium; and thymus primordium. Orthologous to human USP15 (ubiquitin specific peptidase 15).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
4921514G19Rik; AI327321; deubiquitinating enzyme 15; E430033I05Rik; Gcap; Gcap18; granule cell antiserum positive 18; mKIAA0529; ubiquitin carboxyl-terminal hydrolase 15; ubiquitin specific protease 15; ubiquitin thioesterase 15; ubiquitin thiolesterase 15; ubiquitin-specific-processing protease 15
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
USP15 (ubiquitin specific peptidase 15) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Usp15 (ubiquitin specific peptidase 15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Usp15 (ubiquitin specific peptidase 15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
USP15 (ubiquitin specific peptidase 15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
USP15 (ubiquitin specific peptidase 15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Usp15 (ubiquitin specific peptidase 15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
USP15 (ubiquitin specific peptidase 15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
USP15 (ubiquitin specific peptidase 15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Usp15 (ubiquitin specific peptidase 15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
USP4 (ubiquitin specific peptidase 4) HGNC
OrthoMCL
Homo sapiens (human):
USP11 (ubiquitin specific peptidase 11) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Usp15 (ubiquitin specific peptidase 15)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
USP15 (ubiquitin specific peptidase 15)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
usp15 (ubiquitin specific peptidase 15)
Alliance
DIOPT (OrthoFinder|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
UBP12
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
H34C03.2
Alliance
DIOPT (Hieranoid|InParanoid|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
usp15
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Gm18605
Gm21063
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 122,940,911 - 123,032,924 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 122,940,911 - 123,032,900 (-) Ensembl GRCm39 Ensembl GRCm38 10 123,105,006 - 123,197,281 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 123,105,006 - 123,196,995 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 122,550,300 - 122,633,979 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 122,516,304 - 122,599,983 (-) NCBI MGSCv36 mm8 Celera 10 125,493,807 - 125,579,763 (-) NCBI Celera Cytogenetic Map 10 D2 NCBI cM Map 10 72.31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp15 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP15 mRNA CTD PMID:22206623 Usp15 Mouse 1-nitropyrene increases expression ISO RGD:733296 6480464 1-nitropyrene results in increased expression of USP15 mRNA CTD PMID:19041380 Usp15 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:733296 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of USP15 protein CTD PMID:31675489 Usp15 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of USP15 mRNA CTD PMID:21570461 Usp15 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of USP15 mRNA CTD PMID:15034205 Usp15 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of USP15 mRNA] CTD PMID:15034205 Usp15 Mouse 2,4,6-tribromophenol increases expression ISO RGD:733296 6480464 2,4,6-tribromophenol results in increased expression of USP15 mRNA CTD PMID:31675489 Usp15 Mouse 2,6-dinitrotoluene affects expression ISO RGD:628795 6480464 2,6-dinitrotoluene affects the expression of USP15 mRNA CTD PMID:21346803 Usp15 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:733296 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Usp15 Mouse 4,4'-diaminodiphenylmethane affects expression EXP 6480464 4,4'-diaminodiphenylmethane affects the expression of USP15 mRNA CTD PMID:18648102 Usp15 Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of USP15 mRNA CTD PMID:28973697 Usp15 Mouse 6-propyl-2-thiouracil increases expression ISO RGD:628795 6480464 Propylthiouracil results in increased expression of USP15 mRNA CTD PMID:30047161 Usp15 Mouse acetohydrazide decreases expression EXP 6480464 acetylhydrazine results in decreased expression of USP15 mRNA CTD PMID:15282401 Usp15 Mouse acetylsalicylic acid increases expression ISO RGD:733296 6480464 Aspirin results in increased expression of USP15 mRNA CTD PMID:11906190 Usp15 Mouse acrylamide increases expression ISO RGD:628795 6480464 Acrylamide results in increased expression of USP15 mRNA CTD PMID:28959563 Usp15 Mouse acrylamide decreases expression ISO RGD:628795 6480464 Acrylamide results in decreased expression of USP15 mRNA CTD PMID:28959563 Usp15 Mouse aflatoxin B1 increases methylation ISO RGD:733296 6480464 Aflatoxin B1 results in increased methylation of USP15 intron CTD PMID:30157460 Usp15 Mouse amitrole increases expression ISO RGD:628795 6480464 Amitrole results in increased expression of USP15 mRNA CTD PMID:30047161 Usp15 Mouse ammonium chloride affects expression ISO RGD:628795 6480464 Ammonium Chloride affects the expression of USP15 mRNA CTD PMID:16483693 Usp15 Mouse antirheumatic drug decreases expression ISO RGD:733296 6480464 Antirheumatic Agents results in decreased expression of USP15 mRNA CTD PMID:24449571 Usp15 Mouse aristolochic acid A decreases expression ISO RGD:733296 6480464 aristolochic acid I results in decreased expression of USP15 mRNA CTD PMID:33212167 Usp15 Mouse arsenite(3-) increases expression EXP 6480464 arsenite results in increased expression of USP15 protein CTD PMID:37955338 Usp15 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of USP15 mRNA CTD PMID:17942131 Usp15 Mouse benzo[a]pyrene increases expression ISO RGD:733296 6480464 Benzo(a)pyrene results in increased expression of USP15 protein CTD PMID:33278487 Usp15 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of USP15 mRNA CTD PMID:15034205 Usp15 Mouse benzo[a]pyrene multiple interactions EXP 6480464 AHR protein inhibits the reaction [Benzo(a)pyrene results in increased expression of USP15 mRNA] CTD PMID:15034205 Usp15 Mouse benzo[e]pyrene increases methylation ISO RGD:733296 6480464 benzo(e)pyrene results in increased methylation of USP15 intron CTD PMID:30157460 Usp15 Mouse beta-endorphin increases expression ISO RGD:733296 6480464 beta-Endorphin results in increased expression of USP15 mRNA CTD PMID:24068670 Usp15 Mouse bisphenol A decreases expression ISO RGD:628795 6480464 bisphenol A results in decreased expression of USP15 mRNA CTD PMID:25181051 Usp15 Mouse bisphenol A increases expression ISO RGD:733296 6480464 bisphenol A results in increased expression of USP15 protein CTD PMID:34186270 Usp15 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP15 mRNA CTD PMID:33221593 Usp15 Mouse bisphenol A affects methylation ISO RGD:733296 6480464 bisphenol A affects the methylation of USP15 gene CTD PMID:33391824 Usp15 Mouse bisphenol A multiple interactions ISO RGD:733296 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Usp15 Mouse bisphenol F multiple interactions ISO RGD:733296 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Usp15 Mouse butanal decreases expression ISO RGD:733296 6480464 butyraldehyde results in decreased expression of USP15 mRNA CTD PMID:26079696 Usp15 Mouse cadmium dichloride increases expression ISO RGD:733296 6480464 Cadmium Chloride results in increased expression of USP15 protein CTD PMID:24527689 Usp15 Mouse caffeine decreases phosphorylation ISO RGD:733296 6480464 Caffeine results in decreased phosphorylation of USP15 protein CTD PMID:35688186 Usp15 Mouse calcium atom multiple interactions ISO RGD:733296 6480464 Calcium affects the reaction [Morphine results in increased expression of USP15 mRNA] CTD PMID:24068670 Usp15 Mouse calcium(0) multiple interactions ISO RGD:733296 6480464 Calcium affects the reaction [Morphine results in increased expression of USP15 mRNA] CTD PMID:24068670 Usp15 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of USP15 mRNA CTD PMID:37019170 Usp15 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Usp15 Mouse cobalt dichloride increases expression ISO RGD:628795 6480464 cobaltous chloride results in increased expression of USP15 mRNA CTD PMID:24386269 Usp15 Mouse cobalt dichloride increases expression ISO RGD:733296 6480464 cobaltous chloride results in increased expression of USP15 mRNA CTD PMID:19376846 Usp15 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos, Crocidolite results in decreased expression of USP15 mRNA CTD PMID:29279043 Usp15 Mouse CU-O LINKAGE increases expression ISO RGD:733296 6480464 cupric oxide results in increased expression of USP15 mRNA CTD PMID:22077320 Usp15 Mouse cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of USP15 mRNA CTD PMID:17942131 Usp15 Mouse decabromodiphenyl ether increases expression ISO RGD:733296 6480464 decabromobiphenyl ether results in increased expression of USP15 protein CTD PMID:31675489 Usp15 Mouse deoxynivalenol increases expression ISO RGD:733296 6480464 deoxynivalenol results in increased expression of USP15 mRNA CTD PMID:22846391 Usp15 Mouse dexamethasone multiple interactions ISO RGD:733296 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Usp15 Mouse Dibutyl phosphate affects expression ISO RGD:733296 6480464 di-n-butylphosphoric acid affects the expression of USP15 mRNA CTD PMID:37042841 Usp15 Mouse dicrotophos decreases expression ISO RGD:733296 6480464 dicrotophos results in decreased expression of USP15 mRNA CTD PMID:28302478 Usp15 Mouse dioxygen decreases expression ISO RGD:733296 6480464 Oxygen deficiency results in decreased expression of USP15 mRNA CTD PMID:17175027 Usp15 Mouse dioxygen multiple interactions EXP 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of USP15 mRNA] CTD PMID:22629407 Usp15 Mouse dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of USP15 mRNA CTD PMID:22629407 Usp15 Mouse dorsomorphin multiple interactions ISO RGD:733296 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Usp15 Mouse enzyme inhibitor multiple interactions ISO RGD:733296 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Usp15 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of USP15 mRNA CTD PMID:30319688 Usp15 Mouse ethyl methanesulfonate increases expression ISO RGD:733296 6480464 Ethyl Methanesulfonate results in increased expression of USP15 mRNA CTD PMID:23649840 Usp15 Mouse flavonoids increases expression ISO RGD:628795 6480464 Flavonoids results in increased expression of USP15 mRNA CTD PMID:18035473 Usp15 Mouse flutamide increases expression ISO RGD:628795 6480464 Flutamide results in increased expression of USP15 mRNA CTD PMID:24136188 Usp15 Mouse folic acid multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP15 mRNA; [Methionine deficiency co-treated more ... CTD PMID:20938992|PMID:22206623 Usp15 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of USP15 mRNA CTD PMID:25629700 Usp15 Mouse formaldehyde increases expression ISO RGD:733296 6480464 Formaldehyde results in increased expression of USP15 mRNA CTD PMID:23649840 Usp15 Mouse FR900359 affects phosphorylation ISO RGD:733296 6480464 FR900359 affects the phosphorylation of USP15 protein CTD PMID:37730182 Usp15 Mouse fumonisin B1 decreases expression EXP 6480464 fumonisin B1 results in decreased expression of USP15 mRNA CTD PMID:16221962 Usp15 Mouse genistein increases expression EXP 6480464 Genistein results in increased expression of USP15 mRNA CTD PMID:32186404 Usp15 Mouse gentamycin increases expression ISO RGD:628795 6480464 Gentamicins results in increased expression of USP15 mRNA CTD PMID:33387578 Usp15 Mouse gold atom decreases expression ISO RGD:733296 6480464 Gold results in decreased expression of USP15 mRNA CTD PMID:25523186 Usp15 Mouse gold(0) decreases expression ISO RGD:733296 6480464 Gold results in decreased expression of USP15 mRNA CTD PMID:25523186 Usp15 Mouse hypochlorous acid increases expression EXP 6480464 Hypochlorous Acid results in increased expression of USP15 mRNA CTD PMID:19376150 Usp15 Mouse indometacin multiple interactions ISO RGD:733296 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Usp15 Mouse ivermectin decreases expression ISO RGD:733296 6480464 Ivermectin results in decreased expression of USP15 protein CTD PMID:32959892 Usp15 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Usp15 Mouse leflunomide increases expression ISO RGD:628795 6480464 leflunomide results in increased expression of USP15 mRNA CTD PMID:24136188 Usp15 Mouse manganese atom decreases expression ISO RGD:733296 6480464 Manganese results in decreased expression of USP15 mRNA CTD PMID:17175027 Usp15 Mouse manganese(0) decreases expression ISO RGD:733296 6480464 Manganese results in decreased expression of USP15 mRNA CTD PMID:17175027 Usp15 Mouse manganese(II) chloride decreases expression ISO RGD:733296 6480464 manganese chloride results in decreased expression of USP15 mRNA CTD PMID:17175027 Usp15 Mouse methapyrilene increases methylation ISO RGD:733296 6480464 Methapyrilene results in increased methylation of USP15 intron CTD PMID:30157460 Usp15 Mouse methimazole increases expression ISO RGD:628795 6480464 Methimazole results in increased expression of USP15 mRNA CTD PMID:30047161 Usp15 Mouse methotrexate decreases expression ISO RGD:733296 6480464 Methotrexate results in decreased expression of USP15 mRNA CTD PMID:24449571 Usp15 Mouse methyl methanesulfonate increases expression ISO RGD:733296 6480464 Methyl Methanesulfonate results in increased expression of USP15 mRNA CTD PMID:23649840 Usp15 Mouse morphine multiple interactions ISO RGD:733296 6480464 Calcium affects the reaction [Morphine results in increased expression of USP15 mRNA]; CTAP octapeptide inhibits more ... CTD PMID:24068670 Usp15 Mouse morphine increases expression ISO RGD:733296 6480464 Morphine results in increased expression of USP15 mRNA; Morphine results in increased expression of USP15 more ... CTD PMID:24068670 Usp15 Mouse N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO RGD:628795 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [NFE2L2 protein inhibits the reaction [Streptozocin results in increased expression more ... CTD PMID:35478295 Usp15 Mouse oxaliplatin multiple interactions ISO RGD:628795 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP15 mRNA CTD PMID:25729387 Usp15 Mouse paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of USP15 mRNA CTD PMID:17942131 Usp15 Mouse perfluorooctane-1-sulfonic acid decreases expression ISO RGD:733296 6480464 perfluorooctane sulfonic acid results in decreased expression of USP15 mRNA CTD PMID:27153767 Usp15 Mouse phenylmercury acetate increases expression ISO RGD:733296 6480464 Phenylmercuric Acetate results in increased expression of USP15 mRNA CTD PMID:26272509 Usp15 Mouse phenylmercury acetate multiple interactions ISO RGD:733296 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Usp15 Mouse rotenone decreases expression ISO RGD:628795 6480464 Rotenone results in decreased expression of USP15 protein CTD PMID:35544339 Usp15 Mouse SB 431542 multiple interactions ISO RGD:733296 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Usp15 Mouse silicon dioxide increases methylation ISO RGD:733296 6480464 Silicon Dioxide results in increased methylation of USP15 gene; Silicon Dioxide results in increased methylation more ... CTD PMID:34973136 Usp15 Mouse streptozocin increases expression ISO RGD:628795 6480464 Streptozocin results in increased expression of USP15 mRNA; Streptozocin results in increased expression of USP15 more ... CTD PMID:35478295 Usp15 Mouse streptozocin multiple interactions ISO RGD:628795 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [NFE2L2 protein inhibits the reaction [Streptozocin results in increased expression more ... CTD PMID:35478295 Usp15 Mouse thioacetamide increases expression ISO RGD:628795 6480464 Thioacetamide results in increased expression of USP15 mRNA CTD PMID:34492290 Usp15 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of USP15 promoter CTD PMID:35295148 Usp15 Mouse topotecan decreases expression ISO RGD:628795 6480464 Topotecan results in decreased expression of USP15 mRNA CTD PMID:25729387 Usp15 Mouse topotecan multiple interactions ISO RGD:628795 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP15 mRNA CTD PMID:25729387 Usp15 Mouse Tributyltin oxide decreases expression EXP 6480464 bis(tri-n-butyltin)oxide results in decreased expression of USP15 mRNA CTD PMID:17942131 Usp15 Mouse trichostatin A increases expression ISO RGD:733296 6480464 trichostatin A results in increased expression of USP15 mRNA CTD PMID:24935251 Usp15 Mouse trimellitic anhydride increases expression EXP 6480464 trimellitic anhydride results in increased expression of USP15 mRNA CTD PMID:19042947 Usp15 Mouse triphenyl phosphate affects expression ISO RGD:733296 6480464 triphenyl phosphate affects the expression of USP15 mRNA CTD PMID:37042841 Usp15 Mouse tungsten decreases expression EXP 6480464 Tungsten results in decreased expression of USP15 mRNA CTD PMID:30912803 Usp15 Mouse valproic acid increases methylation ISO RGD:733296 6480464 Valproic Acid results in increased methylation of USP15 gene CTD PMID:29154799 Usp15 Mouse valproic acid multiple interactions ISO RGD:733296 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Usp15 Mouse valproic acid increases expression ISO RGD:733296 6480464 Valproic Acid results in increased expression of USP15 mRNA CTD PMID:19101580|PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:28001369 Usp15 Mouse valproic acid affects expression ISO RGD:733296 6480464 Valproic Acid affects the expression of USP15 mRNA CTD PMID:25979313 Usp15 Mouse vinclozolin increases expression ISO RGD:628795 6480464 vinclozolin results in increased expression of USP15 mRNA CTD PMID:23034163 Usp15 Mouse vinclozolin increases methylation ISO RGD:628795 6480464 vinclozolin results in increased methylation of USP15 gene CTD PMID:31682807
1,2-dimethylhydrazine (EXP) 1-nitropyrene (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-tribromophenol (ISO) 2,6-dinitrotoluene (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4-hydroxyphenyl retinamide (EXP) 6-propyl-2-thiouracil (ISO) acetohydrazide (EXP) acetylsalicylic acid (ISO) acrylamide (ISO) aflatoxin B1 (ISO) amitrole (ISO) ammonium chloride (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (EXP) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) beta-endorphin (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) calcium atom (ISO) calcium(0) (ISO) chlorpyrifos (EXP) choline (EXP) cobalt dichloride (ISO) crocidolite asbestos (EXP) CU-O LINKAGE (ISO) cyclosporin A (EXP) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dioxygen (EXP,ISO) dorsomorphin (ISO) enzyme inhibitor (ISO) ethanol (EXP) ethyl methanesulfonate (ISO) flavonoids (ISO) flutamide (ISO) folic acid (EXP) formaldehyde (ISO) FR900359 (ISO) fumonisin B1 (EXP) genistein (EXP) gentamycin (ISO) gold atom (ISO) gold(0) (ISO) hypochlorous acid (EXP) indometacin (ISO) ivermectin (ISO) L-methionine (EXP) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methimazole (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) morphine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) oxaliplatin (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) rotenone (ISO) SB 431542 (ISO) silicon dioxide (ISO) streptozocin (ISO) thioacetamide (ISO) titanium dioxide (EXP) topotecan (ISO) Tributyltin oxide (EXP) trichostatin A (ISO) trimellitic anhydride (EXP) triphenyl phosphate (ISO) tungsten (EXP) valproic acid (ISO) vinclozolin (ISO)
Biological Process
BMP signaling pathway (ISO,ISS) monoubiquitinated protein deubiquitination (ISO,ISS) negative regulation of antifungal innate immune response (ISO,ISS) negative regulation of transforming growth factor beta receptor signaling pathway (ISO,ISS) positive regulation of RIG-I signaling pathway (IEA,ISO) protein deubiquitination (IMP,ISO,ISS) protein K27-linked deubiquitination (ISO,ISS) proteolysis (IEA) regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator (IMP) regulation of RNA metabolic process (ISO) transcription elongation-coupled chromatin remodeling (IBA,ISO,ISS) transforming growth factor beta receptor signaling pathway (IEA,ISO)
1.
The three 'P's of mitophagy: PARKIN, PINK1, and post-translational modifications.
Durcan TM and Fon EA, Genes Dev. 2015 May 15;29(10):989-99. doi: 10.1101/gad.262758.115.
2.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
3.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
De-regulated STAT5A/miR-202-5p/USP15/Caspase-6 regulatory axis suppresses CML cell apoptosis and contributes to Imatinib resistance.
Nie ZY, etal., J Exp Clin Cancer Res. 2020 Jan 17;39(1):17. doi: 10.1186/s13046-019-1502-7.
6.
Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Okazaki N, etal., DNA Res 2003 Feb 28;10(1):35-48.
7.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Usp15 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 122,940,911 - 123,032,924 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 122,940,911 - 123,032,900 (-) Ensembl GRCm39 Ensembl GRCm38 10 123,105,006 - 123,197,281 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 123,105,006 - 123,196,995 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 122,550,300 - 122,633,979 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 122,516,304 - 122,599,983 (-) NCBI MGSCv36 mm8 Celera 10 125,493,807 - 125,579,763 (-) NCBI Celera Cytogenetic Map 10 D2 NCBI cM Map 10 72.31 NCBI
USP15 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 62,260,404 - 62,416,389 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 62,260,338 - 62,417,431 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 62,654,185 - 62,810,169 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 60,940,454 - 61,086,165 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 60,940,453 - 61,086,165 NCBI Celera 12 62,323,221 - 62,468,927 (+) NCBI Celera Cytogenetic Map 12 q14.1 NCBI HuRef 12 59,705,057 - 59,854,661 (+) NCBI HuRef CHM1_1 12 62,622,031 - 62,771,333 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 62,239,218 - 62,395,185 (+) NCBI T2T-CHM13v2.0
Usp15 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 60,643,611 - 60,805,137 (-) NCBI GRCr8 mRatBN7.2 7 58,756,714 - 58,848,778 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 58,756,872 - 58,848,721 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 60,630,453 - 60,720,966 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 62,833,103 - 62,923,616 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 62,610,431 - 62,700,867 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 66,595,707 - 66,687,707 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 66,595,742 - 66,687,278 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 66,793,539 - 66,885,533 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 62,871,167 - 62,961,405 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 62,891,896 - 62,982,135 (-) NCBI Celera 7 55,929,201 - 56,019,813 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
Usp15 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 9,403,097 - 9,533,653 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 9,440,645 - 9,533,653 (+) NCBI ChiLan1.0 ChiLan1.0
USP15 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 31,944,328 - 32,090,448 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 31,937,511 - 32,086,939 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 26,533,441 - 26,682,964 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 26,808,337 - 26,954,099 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 26,808,337 - 26,954,099 (-) Ensembl panpan1.1 panPan2
USP15 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 5,510,759 - 5,634,954 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 5,510,022 - 5,634,202 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 5,502,702 - 5,627,025 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 5,544,390 - 5,667,454 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 5,544,428 - 5,668,750 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 5,485,628 - 5,610,126 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 5,734,844 - 5,859,330 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 5,874,448 - 5,998,972 (+) NCBI UU_Cfam_GSD_1.0
Usp15 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 53,015,395 - 53,131,801 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936545 978,280 - 1,095,659 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936545 978,318 - 1,094,729 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP15 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 26,964,553 - 27,097,444 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 26,964,380 - 27,082,549 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 29,580,789 - 29,800,904 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP15 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 58,154,905 - 58,300,431 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 58,154,919 - 58,300,522 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 187,509,595 - 187,654,699 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp15
.
Predicted Target Of
Count of predictions: 65 Count of miRNA genes: 57 Interacting mature miRNAs: 62 Transcripts: ENSMUST00000020334 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
27226772 Tibl13_m tibia length 13, 10 week (mouse) 10 18875748 129635869 Mouse 4141361 Cfmq3_m cystic fibrosis modifier QTL 3 (mouse) Not determined 10 101497164 130530862 Mouse 4141487 Tgq21_m triglyceride QTL 21 (mouse) Not determined 104110021 130530862 Mouse 4141742 Psds4_m psoriasis-like skin disease severity 4 (mouse) Not determined 122041304 124883196 Mouse 27226764 Tibl19_m tibia length 19, 16 week (mouse) 10 39175996 129635869 Mouse 1301895 Exq1_m exploratory and excitability QTL 1 (mouse) Not determined 10 102847852 130530862 Mouse 14746996 Manh69_m mandible shape 69 (mouse) 10 104763638 130530862 Mouse 1301901 Im5_m immunoregulatory 5 (mouse) Not determined 10 101497164 130530862 Mouse 1302067 Scc9_m colon tumor susceptibility 9 (mouse) Not determined 10 18259333 125575232 Mouse 11039496 Ltpr5b_m Leishmania tropica response 5b (mouse) 10 108575094 130530862 Mouse 1357744 Cfbw4_m cystic fibrosis body weight 4 (mouse) Not determined 10 100986516 130530862 Mouse 11041664 Lmr25_m leishmaniasis resistance 25 (mouse) 10 108575094 130530862 Mouse 1302200 Sle12_m systematic lupus erythematosus susceptibility 12 (mouse) Not determined 10 105041304 130530862 Mouse 26884405 Huml2_m humerus length 2, 5 week (mouse) 10 69735830 130430862 Mouse 12911220 Frct3c_m fear conditioning traits 3c (mouse) 10 122785970 129466996 Mouse 11039516 Ltpr5_m Leishmania tropica response 5 (mouse) 10 90506901 125575232 Mouse 27226795 Scvln17_m sacral vertebrae length 2, 16 week (mouse) 10 118435905 124835905 Mouse 4142089 Obrq9_m obesity resistance QTL 9 (mouse) Not determined 108515907 130530862 Mouse 12911218 Frct3a_m fear conditioning traits 3a (mouse) 10 122785970 129466996 Mouse 27226791 Feml8_m femur length 8, 5 week (mouse) 10 119035905 125735869 Mouse 13506931 Recrq11_m recombination rate in male meiosis QTL 11 (mouse) 10 114335905 123635905 Mouse 1357482 Nhdlq4_m non-HDL QTL 4 (mouse) Not determined 10 105041304 130530862 Mouse 27226784 Tibl4_m tibia length 4, 5 week (mouse) 10 119035905 125435869 Mouse 27226718 Tibw3_m tibia width 3, proximal, 10 week (mouse) 10 118835905 125435869 Mouse 26884443 Sklq5_m skull length QTL 5, 5 week (mouse) 10 119035905 124835905 Mouse 4142461 Bmd25_m bone mineral density 25 (mouse) Not determined 10 97217101 130530862 Mouse 1301968 Estq4_m estradiol regulated response QTL 4 (mouse) Not determined 10 100986516 130530862 Mouse 27095902 Scvln11_m sacral vertebrae length 2, 10 week (mouse) 10 110035861 125435869 Mouse 11353838 Gluq3_m blood glucose QTL 3 (mouse) 10 120243727 125515907 Mouse 11353832 Pcholq4_m plasma cholesterol QTL 4 (mouse) 10 73987216 125515907 Mouse 12879490 Frct3_m fear conditioning traits 3 (mouse) 10 122785970 129466996 Mouse 11353834 Pcholq2_m plasma cholesterol QTL 2 (mouse) 10 120243727 125515907 Mouse 11049570 Lmr25b_m leishmaniasis resistance 25b (mouse) 10 108575094 130530862 Mouse 26884433 Zlq2_m zygomatic length QTL 2, 5 week (mouse) 10 113535905 125735869 Mouse 11533921 Mvb2_m modifier of vibrator 2 (mouse) 10 97217101 130530862 Mouse 26884430 Zlq5_m zygomatic length QTL 5, 10 week (mouse) 10 67835830 124835905 Mouse 1300679 Nociq2_m nociceptive sensitivity inflammatory QTL 2 (mouse) Not determined 10 105041304 130530862 Mouse 1300678 Leg2_m longevity extending gene 2 (mouse) Not determined 10 102506908 130530862 Mouse 1301701 Aggr1_m aggression 1 (mouse) Not determined 10 119506908 125575232 Mouse 12880413 V125Dq9_m vitamin D active form serum level QTL 9 (mouse) 10 97535905 130530862 Mouse 11353843 Gluq1_m blood glucose QTL 1 (mouse) 10 73987216 125515907 Mouse 4141153 Ltgq2_m liver triglyceride QTL 2 (mouse) Not determined 108515907 130530862 Mouse 27226747 Metcl10_m metatarsal-calcaneal length 10, 10 week (mouse) 10 119035905 124835905 Mouse 4141402 T2dm1sa_m type 2 diabetes mellitus 1 in SMXA RI mice (mouse) Not determined 97758644 130530862 Mouse 27226742 Metcl4_m metatarsal-calcaneal length 4, 5 week (mouse) 10 118135905 125435869 Mouse 27095926 Pglq4_m pelvic girdle length QTL 4, 5 week (mouse) 10 119035905 124835905 Mouse 1301758 Fcsa3_m femoral cross-sectional area 3 (mouse) Not determined 10 89927651 123927754 Mouse 27226736 Metcl15_m metatarsal-calcaneal length 15, 16 week (mouse) 10 119035905 124835905 Mouse 11533919 Mvb4_m modifier of vibrator 4 (mouse) 3 97217101 130530862 Mouse 4141007 Obrq10_m obesity resistance QTL 10 (mouse) Not determined 103243727 130530862 Mouse 11353823 Homaq2_m homeostatic model assessment QTL 2 (mouse) 10 110453347 125515907 Mouse 11049563 Lmr25a_m leishmaniasis resistance 25a (mouse) 10 108575094 130530862 Mouse 11353822 Insq12_m insulin QTL 12 (mouse) 10 110453347 125515907 Mouse 14696727 Kidrq2_m kidney weight, right QTL 2 (mouse) 10 102902508 130530862 Mouse 11040593 Lmr5e_m leishmaniasis resistance 5e (mouse) 10 99220635 130530862 Mouse 27095911 Pglq15_m pelvic girdle length QTL 15, 16 week (mouse) 10 39175996 129635869 Mouse 27226725 Tibw1_m tibia width 1, proximal, 5 week (mouse) 10 102735861 123235905 Mouse 11040594 Lmr5f_m leishmaniasis resistance 5f (mouse) 10 105179713 130530862 Mouse 11040595 Lmr5c_m leishmaniasis resistance 5c (mouse) 10 99220635 130530862 Mouse 1357544 Vtbt10_m vertebral trabecular bone trait 10 (mouse) Not determined 10 97217101 130530862 Mouse 11040596 Lmr5d_m leishmaniasis resistance 5d (mouse) 10 105179713 130530862 Mouse 11040597 Lmr5a_m leishmaniasis resistance 5a (mouse) 10 99220635 130530862 Mouse 27226722 Tibw7_m tibia width 7, proximal, 16 week (mouse) 10 108635861 125435869 Mouse 11040598 Lmr5b_m leishmaniasis resistance 5b (mouse) 10 105179713 130530862 Mouse 27095906 Scvln5_m sacral vertebrae length 2, 5 week (mouse) 10 119035905 124835905 Mouse
AI451661
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 10 123,108,911 - 123,108,997 UniSTS GRCm38 MGSCv37 10 122,545,967 - 122,546,053 UniSTS GRCm37 Celera 10 125,489,473 - 125,489,559 UniSTS Cytogenetic Map 10 D3 UniSTS Whitehead/MRC_RH 10 1277.22 UniSTS
AI327321
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 10 123,112,896 - 123,113,057 UniSTS GRCm38 MGSCv37 10 122,549,952 - 122,550,113 UniSTS GRCm37 Celera 10 125,493,459 - 125,493,620 UniSTS Cytogenetic Map 10 D3 UniSTS Whitehead/MRC_RH 10 1277.22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000020334 ⟹ ENSMUSP00000020334
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 122,947,641 - 123,032,858 (-) Ensembl GRCm38.p6 Ensembl 10 123,111,736 - 123,196,953 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000217985
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 122,987,423 - 123,032,832 (-) Ensembl GRCm38.p6 Ensembl 10 123,151,518 - 123,196,927 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000218042
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 122,949,523 - 122,955,386 (-) Ensembl GRCm38.p6 Ensembl 10 123,113,618 - 123,119,481 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000218079
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 122,966,131 - 123,017,706 (-) Ensembl GRCm38.p6 Ensembl 10 123,130,226 - 123,181,801 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000219010
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 122,997,352 - 123,032,831 (-) Ensembl GRCm38.p6 Ensembl 10 123,161,447 - 123,196,926 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000219413
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 122,957,391 - 122,983,235 (-) Ensembl GRCm38.p6 Ensembl 10 123,121,486 - 123,147,330 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000219619 ⟹ ENSMUSP00000152028
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 122,999,520 - 123,032,831 (-) Ensembl GRCm38.p6 Ensembl 10 123,163,615 - 123,196,926 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000219937
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 122,949,133 - 122,963,790 (-) Ensembl GRCm38.p6 Ensembl 10 123,113,228 - 123,127,885 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000219992
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 122,960,200 - 123,032,871 (-) Ensembl GRCm38.p6 Ensembl 10 123,124,295 - 123,196,966 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000220284
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 122,988,265 - 123,032,846 (-) Ensembl GRCm38.p6 Ensembl 10 123,152,360 - 123,196,941 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000220377 ⟹ ENSMUSP00000151244
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 10 122,940,911 - 123,032,900 (-) Ensembl GRCm38.p6 Ensembl 10 123,105,006 - 123,196,995 (-) Ensembl
RefSeq Acc Id:
NM_001301628 ⟹ NP_001288557
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 10 122,940,911 - 123,032,924 (-) NCBI GRCm38 10 123,105,006 - 123,197,019 (-) NCBI Celera 10 125,485,566 - 125,579,859 (-) NCBI
Sequence:
GGTACAGACCTGCCGGCGGGGCGGGGCCGGGGACGCCATTCCCACAATGCTCCGGGGCGTGCCGCCGCCGTCGCCGCCGCCTCCGCTACGGCTAGTGGAAGAAGATGGCGGAAGGCGGAGCGGCGGAC
hide sequence
RefSeq Acc Id:
NM_027604 ⟹ NP_081880
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 10 122,940,911 - 123,032,924 (-) NCBI GRCm38 10 123,105,006 - 123,197,019 (-) NCBI MGSCv37 10 122,550,300 - 122,633,979 (-) RGD Celera 10 125,485,566 - 125,579,859 (-) NCBI cM Map 10 ENTREZGENE
Sequence:
GGTACAGACCTGCCGGCGGGGCGGGGCCGGGGACGCCATTCCCACAATGCTCCGGGGCGTGCCGCCGCCGTCGCCGCCGCCTCCGCTACGGCTAGTGGAAGAAGATGGCGGAAGGCGGAGCGGCGGAC
hide sequence
RefSeq Acc Id:
XM_006513225 ⟹ XP_006513288
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 10 122,948,619 - 122,983,124 (-) NCBI GRCm38 10 123,112,714 - 123,147,223 (-) NCBI
Sequence:
TTTTGATGGAGCGATGCAGACTGGAGCAAGCCGTGATGCTACTCCCATTACCGCCGGTGTGAAA
hide sequence
RefSeq Acc Id:
XM_006513226 ⟹ XP_006513289
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 10 122,948,619 - 122,983,412 (-) NCBI GRCm38 10 123,112,714 - 123,147,520 (-) NCBI
Sequence:
GCAGCACTGGCTCTCCTGGCACACAGTCCCTTCAGGGCTCCTCATCAGGAATGTTCTCTGCATC
hide sequence
RefSeq Acc Id:
XM_006513227 ⟹ XP_006513290
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 10 122,948,619 - 122,989,032 (-) NCBI GRCm38 10 123,112,714 - 123,151,125 (-) NCBI
Sequence:
GTCCCCAGGTGCATCCAATTTTTCAACTTTACCAAAGATCTCTCCTTCATCTCTATCAAATAATTATAACAACATCAACAACAGAAATATCCTAGTGTACTCTAGTCTCAGAACCTCGGAAAGAAGAA
hide sequence
RefSeq Acc Id:
XM_006513228 ⟹ XP_006513291
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 10 122,986,862 - 123,032,919 (-) NCBI GRCm38 10 123,150,957 - 123,197,281 (-) NCBI
Sequence:
AGACCTGCCGGCGGGGCGGGGCCGGGGACGCCATTCCCACAATGCTCCGGGGCGTGCCGCCGCC
hide sequence
RefSeq Acc Id:
XM_036155615 ⟹ XP_036011508
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 10 122,948,619 - 123,032,888 (-) NCBI
Sequence:
CATTCCCACAATGCTCCGGGGCGTGCCGCCGCCGTCGCCGCCGCCTCCGCTACGGCTAGTGGAAGAAGATGGCGGAAGGCGGAGCGGCGGACCTGGACACCCAGCGTTCTGACATCGCGACGCTGCTC
hide sequence
RefSeq Acc Id:
XM_036155616 ⟹ XP_036011509
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 10 122,948,619 - 123,032,888 (-) NCBI
Sequence:
CATTCCCACAATGCTCCGGGGCGTGCCGCCGCCGTCGCCGCCGCCTCCGCTACGGCTAGTGGAA
hide sequence
RefSeq Acc Id:
XR_004936099
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 10 122,966,903 - 123,032,919 (-) NCBI
Sequence:
AGACCTGCCGGCGGGGCGGGGCCGGGGACGCCATTCCCACAATGCTCCGGGGCGTGCCGCCGCC
hide sequence
RefSeq Acc Id:
XR_380365
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 10 122,966,903 - 123,032,919 (-) NCBI GRCm38 10 123,132,956 - 123,197,281 (-) NCBI
Sequence:
AGACCTGCCGGCGGGGCGGGGCCGGGGACGCCATTCCCACAATGCTCCGGGGCGTGCCGCCGCC
hide sequence
RefSeq Acc Id:
NP_081880 ⟸ NM_027604
- Peptide Label:
isoform 1
- UniProtKB:
Q80TY6 (UniProtKB/Swiss-Prot), Q3UZH0 (UniProtKB/Swiss-Prot), Q3UL25 (UniProtKB/Swiss-Prot), Q3TTB2 (UniProtKB/Swiss-Prot), Q3TGF5 (UniProtKB/Swiss-Prot), Q80UK9 (UniProtKB/Swiss-Prot), Q8R5H1 (UniProtKB/Swiss-Prot)
- Sequence:
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCK
hide sequence
RefSeq Acc Id:
XP_006513290 ⟸ XM_006513227
- Peptide Label:
isoform X5
- Sequence:
MNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHL
hide sequence
RefSeq Acc Id:
XP_006513289 ⟸ XM_006513226
- Peptide Label:
isoform X4
- Sequence:
MIDCCSVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTE
hide sequence
RefSeq Acc Id:
XP_006513288 ⟸ XM_006513225
- Peptide Label:
isoform X2
- Sequence:
MQTGASRDATPITAGVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQC
hide sequence
RefSeq Acc Id:
XP_006513291 ⟸ XM_006513228
- Peptide Label:
isoform X6
- UniProtKB:
Q3TPH3 (UniProtKB/TrEMBL)
- Sequence:
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGP
hide sequence
RefSeq Acc Id:
NP_001288557 ⟸ NM_001301628
- Peptide Label:
isoform 2
- UniProtKB:
Q8R5H1 (UniProtKB/Swiss-Prot)
- Sequence:
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCK
hide sequence
Ensembl Acc Id:
ENSMUSP00000020334 ⟸ ENSMUST00000020334
Ensembl Acc Id:
ENSMUSP00000152028 ⟸ ENSMUST00000219619
Ensembl Acc Id:
ENSMUSP00000151244 ⟸ ENSMUST00000220377
RefSeq Acc Id:
XP_036011509 ⟸ XM_036155616
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_036011508 ⟸ XM_036155615
- Peptide Label:
isoform X1
RGD ID: 6820079 Promoter ID: MM_KWN:5830 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour Transcripts: UC007HGP.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 10 122,584,296 - 122,585,197 (-) MPROMDB
RGD ID: 6820078 Promoter ID: MM_KWN:5832 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000105258, ENSMUST00000105259, NM_027604, UC007HGO.1, UC007HGQ.1, UC007HGS.1, UC007HGT.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 10 122,633,881 - 122,634,632 (-) MPROMDB
RGD ID: 8673428 Promoter ID: EPDNEW_M14744 Type: initiation region Name: Usp15_1 Description: Mus musculus ubiquitin specific peptidase 15 , transcript variant2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 10 123,196,926 - 123,196,986 EPDNEW
