Advanced Search (OLGA)

Gene: Opn1sw (opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan)) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Opn1sw

Name:

opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan)

RGD ID:

732047

MGI Page

MGI

Description:

Predicted to enable G protein-coupled photoreceptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway; cellular response to UV-A; and phototransduction. Located in cone photoreceptor outer segment. Is expressed in several structures, including brain; genitourinary system; gut; liver and biliary system; and retina. Human ortholog(s) of this gene implicated in blue color blindness. Orthologous to human OPN1SW (opsin 1, short wave sensitive).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

AW551857; Bc; Bcp; blue cone opsin; blue cone photoreceptor pigment; blue cone pigment; blue opsin; blue-sensitive opsin; blue/UV opsin; BOP; S opsin; short wavelength sensitive opsin; short wavelength-sensitive cone opsin; short-wave-sensitive opsin 1; SWS opsin; UV cone pigment

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OPN1SW (opsin 1, short wave sensitive)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Opn1sw (opsin 1, short wave sensitive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Opn1sw (opsin 1, short wave sensitive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	OPN1SW (opsin 1, short wave sensitive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OPN1SW (opsin 1, short wave sensitive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Opn1sw (opsin 1, short wave sensitive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OPN1SW (opsin 1, short wave sensitive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OPN1SW (opsin 1, short wave sensitive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Opn1sw (opsin 1, short wave sensitive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Opn1sw (opsin 1, short wave sensitive)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	OPN1SW (opsin 1, short wave sensitive)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	opn1sw1 (opsin 1 (cone pigments), short-wave-sensitive 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Xenopus tropicalis (tropical clawed frog):	opn1sw	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	29,376,670 - 29,380,512 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	29,376,670 - 29,388,467 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	29,376,671 - 29,380,513 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	29,376,671 - 29,388,468 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	29,326,671 - 29,330,513 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	29,326,680 - 29,330,490 (-)	NCBI		MGSCv36	mm8
Celera	6	29,383,859 - 29,387,702 (-)	NCBI		Celera
Cytogenetic Map	6	A3.3	NCBI
cM Map	6	12.36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Opn1sw	Mouse	autosomal dominant limb-girdle muscular dystrophy type 2		ISO	RGD:736424	8554872	ClinVar Annotator: match by term: Autosomal dominant limb-girdle muscular dystrophy type 1F	ClinVar	PMID:28492532
Opn1sw	Mouse	blue color blindness		ISO	RGD:736424	8554872	ClinVar Annotator: match by term: Blue color blindness \| ClinVar Annotator: match by term: OPN1SW-related more ...	ClinVar	PMID:1386496\|PMID:1531728\|PMID:25741868\|PMID:28492532\|PMID:2937147\|PMID:31816670
Opn1sw	Mouse	pleomorphic xanthoastrocytoma		ISO	RGD:736424	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Opn1sw	Mouse	atrial fibrillation		ISO	RGD:736424	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:29892015

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Opn1sw	Mouse	blue color blindness		ISO	RGD:736424	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Opn1sw	Mouse	ammonium chloride	affects expression	ISO	RGD:621033	6480464	Ammonium Chloride affects the expression of OPN1SW mRNA	CTD	PMID:16483693
Opn1sw	Mouse	aristolochic acid A	increases expression	ISO	RGD:736424	6480464	aristolochic acid I results in increased expression of OPN1SW mRNA	CTD	PMID:33212167
Opn1sw	Mouse	benzo[a]pyrene	multiple interactions	EXP		6480464	Benzo(a)pyrene promotes the reaction [AHR protein binds to OPN1SW promoter]	CTD	PMID:19654925
Opn1sw	Mouse	bisphenol A	decreases expression	ISO	RGD:621033	6480464	bisphenol A results in decreased expression of OPN1SW mRNA	CTD	PMID:25181051
Opn1sw	Mouse	disodium selenite	decreases expression	ISO	RGD:736424	6480464	Sodium Selenite results in decreased expression of OPN1SW mRNA	CTD	PMID:18175754
Opn1sw	Mouse	ethylparaben	decreases expression	ISO	RGD:736424	6480464	ethyl-p-hydroxybenzoate results in decreased expression of OPN1SW mRNA	CTD	PMID:37690743
Opn1sw	Mouse	fenvalerate	increases expression	ISO	RGD:621033	6480464	fenvalerate results in increased expression of OPN1SW mRNA	CTD	PMID:30307764
Opn1sw	Mouse	resveratrol	multiple interactions	ISO	RGD:736424	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of OPN1SW mRNA	CTD	PMID:23557933
Opn1sw	Mouse	rotenone	decreases expression	ISO	RGD:621033	6480464	Rotenone results in decreased expression of OPN1SW mRNA	CTD	PMID:31969611
Opn1sw	Mouse	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of OPN1SW mRNA	CTD	PMID:36209798
Opn1sw	Mouse	Theaflavin 3,3'-digallate	affects expression	ISO	RGD:736424	6480464	theaflavin-3,3'-digallate affects the expression of OPN1SW mRNA	CTD	PMID:34925699
Opn1sw	Mouse	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of OPN1SW mRNA	CTD	PMID:35295148
Opn1sw	Mouse	trichostatin A	decreases expression	ISO	RGD:736424	6480464	trichostatin A results in decreased expression of OPN1SW mRNA	CTD	PMID:24935251
Opn1sw	Mouse	urethane	decreases expression	ISO	RGD:736424	6480464	Urethane results in decreased expression of OPN1SW mRNA	CTD	PMID:28818685
Opn1sw	Mouse	valproic acid	decreases expression	ISO	RGD:736424	6480464	Valproic Acid results in decreased expression of OPN1SW mRNA	CTD	PMID:24383497
Opn1sw	Mouse	vinclozolin	increases methylation	ISO	RGD:621033	6480464	vinclozolin results in increased methylation of OPN1SW gene	CTD	PMID:31682807

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Opn1sw	Mouse	cellular response to light stimulus	involved_in	IBA	PANTHER:PTN008398221\|FB:FBgn0002940\|ZFIN:ZDB-GENE-101129-1\|FB:FBgn0003249\|MGI:2662912\|UniProtKB:D0E2W5\|FB:FBgn0003250\|ZFIN:ZDB-GENE-030314-2\|MGI:97914\|RGD:3573\|UniProtKB:P03999\|UniProtKB:P02699\|UniProtKB:Q6U736\|UniProtKB:Q9H1Y3	2290270		GO_Central	GO_REF:0000033
Opn1sw	Mouse	cellular response to UV-A	involved_in	ISO	UniProtKB:P03999	2290270		GO_Central	GO_REF:0000119
Opn1sw	Mouse	cellular response to UV-A	involved_in	ISS	UniProtKB:P03999	2290270		UniProt	GO_REF:0000024
Opn1sw	Mouse	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	2290270		UniProt	GO_REF:0000043
Opn1sw	Mouse	G protein-coupled receptor signaling pathway	involved_in	IBA	PANTHER:PTN008398221\|UniProtKB:Q9GZN0\|ZFIN:ZDB-GENE-030314-2\|ZFIN:ZDB-GENE-070111-2\|RGD:3573\|ZFIN:ZDB-GENE-991229-12\|UniProtKB:P08100\|FB:FBgn0002940\|UniProtKB:P02699\|ZFIN:ZDB-GENE-080415-3\|ZFIN:ZDB-GENE-110622-1	2290270		GO_Central	GO_REF:0000033
Opn1sw	Mouse	phototransduction	involved_in	IBA	PANTHER:PTN008398221\|UniProtKB:Q6U736\|FB:FBgn0014019\|MGI:1353425\|RGD:621701\|UniProtKB:P02699\|ZFIN:ZDB-GENE-081105-91\|ZFIN:ZDB-GENE-030616-402\|FB:FBgn0003250\|MGI:97914\|ZFIN:ZDB-GENE-030314-2\|RGD:3573\|ZFIN:ZDB-GENE-140106-15\|ZFIN:ZDB-GENE-101129-1\|ZFIN:ZDB-GENE-040724-51\|MGI:2662912\|UniProtKB:Q9UHM6\|FB:FBgn0019940\|ZFIN:ZDB-GENE-130530-850\|FB:FBgn0002940\|ZFIN:ZDB-GENE-061201-30\|ZFIN:ZDB-GENE-151029-1\|FB:FBgn0003249\|UniProtKB:D0E2W5	2290270		GO_Central	GO_REF:0000033
Opn1sw	Mouse	phototransduction	involved_in	IEA	UniProtKB-KW:KW-0681	2290270		UniProt	GO_REF:0000043
Opn1sw	Mouse	visual perception	involved_in	IEA	UniProtKB-KW:KW-0844	2290270		UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Opn1sw	Mouse	cell body		ISO	RGD:621033	9068941		RGD	PMID:20209167\|REF_RGD_ID:6893562
Opn1sw	Mouse	cell body	located_in	ISO	RGD:621033	2290270		GO_Central	GO_REF:0000096
Opn1sw	Mouse	cone photoreceptor outer segment	located_in	IDA		2290270	PMID:10813773	MGI	PMID:10813773
Opn1sw	Mouse	cytosol	located_in	ISO	UniProtKB:P03999	2290270		GO_Central	GO_REF:0000119
Opn1sw	Mouse	intercellular bridge	located_in	ISO	UniProtKB:P03999	2290270		GO_Central	GO_REF:0000119
Opn1sw	Mouse	nucleoplasm	located_in	ISO	UniProtKB:P03999	2290270		GO_Central	GO_REF:0000119
Opn1sw	Mouse	perinuclear region of cytoplasm	located_in	ISO	UniProtKB:P03999	2290270		GO_Central	GO_REF:0000119
Opn1sw	Mouse	perinuclear region of cytoplasm	located_in	ISS	UniProtKB:P03999	2290270		UniProt	GO_REF:0000024
Opn1sw	Mouse	photoreceptor inner segment	located_in	IEA	UniProtKB-SubCell:SL-0457	2290270		UniProt	GO_REF:0000044
Opn1sw	Mouse	photoreceptor outer segment		ISO	RGD:621033	9068941		RGD	PMID:20209167\|REF_RGD_ID:6893562
Opn1sw	Mouse	photoreceptor outer segment	located_in	IDA		2290270	PMID:10725384, PMID:12651948, PMID:19332056, PMID:22183407, PMID:23351594, PMID:23386608, PMID:26420485	MGI	PMID:10725384\|PMID:12651948\|PMID:19332056\|PMID:22183407\|PMID:23351594\|PMID:23386608\|PMID:26420485
Opn1sw	Mouse	photoreceptor outer segment	located_in	ISO	RGD:621033	2290270		GO_Central	GO_REF:0000096
Opn1sw	Mouse	photoreceptor outer segment	is_active_in	IBA	PANTHER:PTN000662150\|UniProtKB:P22328\|UniProtKB:F1P3Y2\|UniProtKB:P08100\|MGI:99438\|RGD:3573\|MGI:97914\|UniProtKB:P02699\|MGI:1097692\|ZFIN:ZDB-GENE-990604-42\|UniProtKB:P22329\|RGD:620978\|ZFIN:ZDB-GENE-990604-40\|RGD:621033\|ZFIN:ZDB-GENE-990415-271\|UniProtKB:F1NEY2	2290270		GO_Central	GO_REF:0000033
Opn1sw	Mouse	plasma membrane	is_active_in	IBA	PANTHER:PTN008398221\|UniProtKB:P03999\|UniProtKB:P22329\|UniProtKB:P02699\|MGI:1929473\|UniProtKB:Q6U736\|RGD:61921\|UniProtKB:Q9H1Y3\|MGI:1353425\|UniProtKB:P08100\|FB:FBgn0002940\|UniProtKB:P04001\|UniProtKB:Q9UHM6\|UniProtKB:Q9GZN0\|MGI:97914\|RGD:3573	2290270		GO_Central	GO_REF:0000033
Opn1sw	Mouse	plasma membrane	located_in	ISO	UniProtKB:P03999	2290270		GO_Central	GO_REF:0000119
Opn1sw	Mouse	plasma membrane	located_in	ISS	UniProtKB:P03999	2290270		UniProt	GO_REF:0000024
Opn1sw	Mouse	terminal bouton		ISO	RGD:621033	9068941		RGD	PMID:20209167\|REF_RGD_ID:6893562
Opn1sw	Mouse	terminal bouton	located_in	ISO	RGD:621033	2290270		GO_Central	GO_REF:0000096

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Opn1sw	Mouse	G protein-coupled photoreceptor activity	enables	IBA	PANTHER:PTN008398221\|RGD:621701\|FB:FBgn0019940\|UniProtKB:P02699\|UniProtKB:F1NEY2\|MGI:1353425\|ZFIN:ZDB-GENE-990415-271\|FB:FBgn0014019\|FB:FBgn0002940\|ZFIN:ZDB-GENE-991229-12\|ZFIN:ZDB-GENE-101129-1\|UniProtKB:D0E2W5\|UniProtKB:Q9UHM6\|FB:FBgn0003249\|MGI:2662912\|FB:FBgn0003250	2290270		GO_Central	GO_REF:0000033
Opn1sw	Mouse	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	2290270		UniProt	GO_REF:0000043
Opn1sw	Mouse	photoreceptor activity	enables	IEA	UniProtKB-KW:KW-0600	2290270		UniProt	GO_REF:0000043
Opn1sw	Mouse	protein binding	enables	ISO	UniProtKB:Q9GZY8-5	9068941	PMID:32296183	IntAct	PMID:32296183

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Opn1sw	Mouse	retinoid cycle metabolic pathway		ISO	RGD:736424	6893536		RGD
Opn1sw	Mouse	visual phototransduction pathway		ISO	RGD:736424	6893536		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Opn1sw	Mouse	abnormal cone electrophysiology		IAGP		5509061		MGI	PMID:22674284
Opn1sw	Mouse	disorganized photoreceptor outer segment		IAGP		5509061		MGI	PMID:22674284

#	Reference Title	Reference Citation
1.	Murine and bovine blue cone pigment genes: cloning and characterization of two new members of the S family of visual pigments.	Chiu MI, etal., Genomics 1994 May 15;21(2):440-3.
2.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
3.	MGDs mouse GO annotations	MGD data from the GO Consortium
4.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Membrane receptors and transporters involved in the function and transport of vitamin A and its derivatives.	Sun H Biochim Biophys Acta. 2012 Jan;1821(1):99-112. Epub 2011 Jun 17.

PMID:1386496	PMID:7558038	PMID:7918227	PMID:10725384	PMID:10813773	PMID:10922068	PMID:11055434	PMID:11138006	PMID:11468275	PMID:11493566	PMID:12407160	PMID:12477932
PMID:12651948	PMID:14742273	PMID:15163632	PMID:15489334	PMID:16043864	PMID:16110338	PMID:16267237	PMID:16452096	PMID:16567464	PMID:16574740	PMID:16602821	PMID:16702404
PMID:16868010	PMID:17341594	PMID:17436273	PMID:18199774	PMID:18803408	PMID:18974269	PMID:18987029	PMID:19014374	PMID:19332056	PMID:19416500	PMID:19805139	PMID:19812316
PMID:19828801	PMID:20107170	PMID:20110327	PMID:20203194	PMID:20463215	PMID:20969844	PMID:21148184	PMID:21151604	PMID:21219924	PMID:21267068	PMID:21558380	PMID:21779340
PMID:21813673	PMID:21850176	PMID:21857657	PMID:21873635	PMID:21903076	PMID:22183407	PMID:22609278	PMID:22674284	PMID:23001562	PMID:23142158	PMID:23223288	PMID:23293286
PMID:23351594	PMID:23386608	PMID:23481413	PMID:23792161	PMID:24421398	PMID:24463367	PMID:24801306	PMID:24801621	PMID:25228773	PMID:25296752	PMID:25416279	PMID:25654255
PMID:25757744	PMID:25776555	PMID:25995483	PMID:26392540	PMID:26420485	PMID:26876013	PMID:26949938	PMID:26965927	PMID:27033727	PMID:27328943	PMID:27677711	PMID:28011038
PMID:28288836	PMID:28331281	PMID:28370415	PMID:28551284	PMID:29209045	PMID:29361558	PMID:29665410	PMID:30208054	PMID:30924851	PMID:31002540	PMID:31448880	PMID:31628458
PMID:31696965	PMID:32221352	PMID:32463363	PMID:32744119	PMID:33007388	PMID:34061953	PMID:34508581	PMID:35471186	PMID:36070393	PMID:36293380	PMID:36537580	PMID:36631163
PMID:36737666	PMID:37033230	PMID:37048108	PMID:38060327	PMID:38089586	PMID:38546215	PMID:39018199

Opn1sw
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	29,376,670 - 29,380,512 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	29,376,670 - 29,388,467 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	29,376,671 - 29,380,513 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	29,376,671 - 29,388,468 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	29,326,671 - 29,330,513 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	29,326,680 - 29,330,490 (-)	NCBI		MGSCv36	mm8
Celera	6	29,383,859 - 29,387,702 (-)	NCBI		Celera
Cytogenetic Map	6	A3.3	NCBI
cM Map	6	12.36	NCBI

OPN1SW
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	128,772,485 - 128,775,794 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	128,772,485 - 128,775,794 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	128,412,539 - 128,415,848 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	128,199,783 - 128,203,087 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	128,006,497 - 128,009,802	NCBI
Celera	7	123,208,297 - 123,211,598 (-)	NCBI		Celera
Cytogenetic Map	7	q32.1	NCBI
HuRef	7	122,773,527 - 122,776,828 (-)	NCBI		HuRef
CHM1_1	7	128,345,783 - 128,349,084 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	130,084,638 - 130,087,947 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	127,795,527 - 127,798,828 (-)	NCBI

Opn1sw
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	58,942,685 - 58,945,825 (-)	NCBI		GRCr8
mRatBN7.2	4	57,977,317 - 57,980,457 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	57,977,313 - 57,980,457 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	62,960,385 - 62,963,525 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	58,876,538 - 58,879,678 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	57,278,435 - 57,281,575 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	56,653,840 - 56,656,980 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	56,653,844 - 56,656,980 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	56,421,001 - 56,424,141 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	56,256,846 - 56,259,986 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	56,512,971 - 56,516,112 (-)	NCBI
Celera	4	53,085,329 - 53,088,469 (-)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

Opn1sw
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955479	9,573,594 - 9,576,668 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955479	9,573,594 - 9,576,668 (-)	NCBI	ChiLan1.0	ChiLan1.0

OPN1SW
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	165,576,694 - 165,584,445 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	17,586,802 - 17,590,192 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	120,724,363 - 120,727,649 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	133,246,131 - 133,251,464 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	133,246,131 - 133,251,464 (-)	Ensembl	panpan1.1		panPan2

OPN1SW
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	7,865,370 - 7,869,516 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	7,865,561 - 7,868,745 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	7,552,256 - 7,555,713 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	7,631,370 - 7,634,827 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	7,630,992 - 7,634,662 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	7,836,320 - 7,839,777 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	7,578,515 - 7,581,972 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	7,723,749 - 7,727,206 (+)	NCBI		UU_Cfam_GSD_1.0

Opn1sw
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	54,572,299 - 54,578,533 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936479	15,699,604 - 15,702,352 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936479	15,696,063 - 15,702,311 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OPN1SW
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	19,836,453 - 19,839,425 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	19,836,453 - 19,839,425 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	20,905,871 - 20,908,843 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OPN1SW
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	97,370,824 - 97,377,433 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	97,372,863 - 97,376,406 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	6,028,013 - 6,032,554 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Opn1sw
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	7,412,825 - 7,416,095 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624783	7,412,825 - 7,416,209 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Opn1sw
160 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	1367
Count of miRNA genes:	608
Interacting mature miRNAs:	755
Transcripts:	ENSMUST00000080428, ENSMUST00000131928, ENSMUST00000147483, ENSMUST00000173653
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4142271	Egq8_m	early growth QTL 8 (mouse)			Not determined			4503823	96633110	Mouse
11353836	Bmiq1_m	body mass index QTL 1 (mouse)					6	4503823	29751333	Mouse
4140989	Spqq2_m	sperm quality QTL 2 (mouse)			Not determined			17711598	51711719	Mouse
26884441	Sklq3_m	skull length QTL 3, 5 week (mouse)					6	7600000	80576983	Mouse
1357520	Axtq2_m	anxiety QTL 2 (mouse)			Not determined		6	4503823	48703611	Mouse
10043869	Cia6a_m	collagen induced arthritis QTL 6a (mouse)			Not determined		6	12117971	46118069	Mouse
1301850	Fglu_m	fasting glucose (mouse)			Not determined		6	17711598	51711719	Mouse
4141749	Obrq2_m	obesity resistance QTL 2 (mouse)			Not determined			12751221	46751333	Mouse
1301724	Pcd4ts1_m	p-glycoprotein positive CD4 T cell subset 1 (mouse)			Not determined		6	17711598	51711719	Mouse
4142126	W3q3_m	weight 3 weeks QTL 3 (mouse)			Not determined			4503823	96633110	Mouse
10412107	Desp4_m	despair 4 (mouse)			Not determined		6	20049830	54049830	Mouse
1357442	Dbts1_m	diabetes 1 (mouse)			Not determined		6	18234147	73364675	Mouse
1301131	Chol2_m	cholesterol 2 (mouse)			Not determined		6	1	32144495	Mouse
1302024	Skull7_m	skull morphology 7 (mouse)			Not determined		6	1	32144495	Mouse
4141988	Obrq3_m	obesity resistance QTL 3 (mouse)			Not determined			28290993	62291115	Mouse
11353841	Bmiq3_m	body mass index QTL 3 (mouse)					6	4503823	48703611	Mouse
11353840	Bmiq2_m	body mass index QTL 2 (mouse)					6	4503823	45291115	Mouse
1300556	Cia6_m	collagen induced arthritis QTL 6 (mouse)			Not determined		6	4464884	87403016	Mouse
5491191	Mobq2_m	multigenic obesity QTL 2 (mouse)			Not determined		6	1	32144495	Mouse
25440480	Moaq2_m	modifier of alien QTL 2 (mouse)					6	3050001	117476961	Mouse
26884414	Bzwq12_m	bi-zygomatic width QTL 12, 16 week (mouse)					6	3400000	139076998	Mouse
4142361	W10q11_m	weight 10 weeks QTL 11 (mouse)			Not determined			4503823	96633110	Mouse
4142232	W6q4_m	weight 6 weeks QTL 4 (mouse)			Not determined			4503823	96633110	Mouse
1300731	Smdq3_m	segregation of mitochondrial DNA QTL 3 (mouse)			Not determined		6	4249206	38249325	Mouse
12904940	Edlmmq5_m	extensor digitorum longus muscle mass QTL 5 (mouse)					6	19616346	53616346	Mouse
15039372	Nmrs22_m	NAFLD-associated magnetic resonance shift 22 (mouse)					6	1476334	35476334	Mouse
12904943	Tammq4_m	tibialis anterior muscle mass QTL 4 (mouse)					6	19616346	53616346	Mouse
10412213	Sxbq2_m	SGC/Knj cross B6 QTL 2 (mouse)			Not determined		6	19912685	71299759	Mouse
1302051	Sluc7_m	susceptibility to lung cancer 7 (mouse)			Not determined		6	9297074	43297168	Mouse
14700690	Ccs6_m	colon cancer susceptibility 6 (mouse)					6	23776934	57776934	Mouse
27226726	Tibmd7_m	tibia midshaft diameter 7, 16 week (mouse)					6	17699999	53476985	Mouse
12904952	Gmmq4_m	gastrocnemius muscle mass QTL 4 (mouse)					6	19616346	53616346	Mouse
1357481	Aaj2_m	anxiety in A/J 2 (mouse)			Not determined		6	4503823	48703611	Mouse
1301998	Bts2_m	bladder tumor susceptibility 2 (mouse)			Not determined		6	12751221	46751333	Mouse
13208564	Bmiq7_m	body mass index QTL 7 (mouse)					6	24999999	79976983	Mouse

AW551857

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	29,377,434 - 29,377,550	UniSTS	GRCm38
MGSCv37	6	29,327,434 - 29,327,550	UniSTS	GRCm37
Celera	6	29,384,622 - 29,384,738	UniSTS
Cytogenetic Map	6	A3.3	UniSTS
Whitehead/MRC_RH	6	232.85	UniSTS

AW541262

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	29,376,389 - 29,376,527	UniSTS	GRCm38
GRCm38	7	12,005,828 - 12,005,964	UniSTS	GRCm38
MGSCv37	7	12,591,177 - 12,591,313	UniSTS	GRCm37
MGSCv37	6	29,326,389 - 29,326,527	UniSTS	GRCm37
Celera	7	9,615,013 - 9,615,149	UniSTS
Celera	6	29,383,577 - 29,383,715	UniSTS
Cytogenetic Map	6	A3.3	UniSTS
Cytogenetic Map	7	A1	UniSTS
Whitehead/MRC_RH	6	232.41	UniSTS
Whitehead/MRC_RH	7	125.45	UniSTS

UniSTS:235394

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	29,376,381 - 29,376,560	UniSTS	GRCm38
MGSCv37	6	29,326,381 - 29,326,560	UniSTS	GRCm37
Celera	6	29,383,569 - 29,383,748	UniSTS
Cytogenetic Map	6	A3.3	UniSTS

Opn1sw

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	29,379,789 - 29,380,309	UniSTS	GRCm38
MGSCv37	6	29,327,985 - 29,328,829	UniSTS	GRCm37
Celera	6	29,386,978 - 29,387,498	UniSTS
Cytogenetic Map	6	A3.3	UniSTS
cM Map	UN		UniSTS
cM Map	6		UniSTS

Opn1sw

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	29,377,985 - 29,378,829	UniSTS	GRCm38
MGSCv37	6	29,327,985 - 29,328,829	UniSTS	GRCm37
Celera	6	29,385,174 - 29,386,018	UniSTS
Cytogenetic Map	6	A3.3	UniSTS
cM Map	UN		UniSTS
cM Map	6		UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_007538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC044807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF190670	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF190671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH005191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC026021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC050002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK620498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U49720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000080428 ⟹ ENSMUSP00000079289

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	6	29,376,670 - 29,380,512 (-)	Ensembl
GRCm38.p6 Ensembl	6	29,376,671 - 29,380,513 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000131928

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	6	29,378,930 - 29,380,412 (-)	Ensembl
GRCm38.p6 Ensembl	6	29,378,931 - 29,380,413 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000147483 ⟹ ENSMUSP00000133745

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	6	29,377,383 - 29,380,430 (-)	Ensembl
GRCm38.p6 Ensembl	6	29,377,384 - 29,380,431 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000173653 ⟹ ENSMUSP00000133534

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	6	29,379,372 - 29,388,467 (-)	Ensembl
GRCm38.p6 Ensembl	6	29,379,373 - 29,388,468 (-)	Ensembl

RefSeq Acc Id:

NM_007538 ⟹ NP_031564

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	6	29,376,670 - 29,380,512 (-)	NCBI
GRCm38	6	29,376,671 - 29,380,513 (-)	NCBI
MGSCv37	6	29,326,671 - 29,330,513 (-)	RGD
Celera	6	29,383,859 - 29,387,702 (-)	RGD
cM Map	6		ENTREZGENE

Sequence:

show sequence

CTGTATCTTTAAAGGAGGGTGCTGTAGGGAAGGGTGATAGCAGAAGAATCGTCTATAAGAGGGACCGGAGGTGGTAGTGAGGGCATCCCAAGCGGGAGATGTCAGGAGAGGATGACTTTTACCTGTTT
CAGAATATCTCTTCGGTGGGGCCCTGGGATGGGCCTCAGTACCACCTTGCTCCTGTCTGGGCCTTCCGCCTCCAGGCAGCCTTCATGGGATTTGTCTTCTTTGTGGGGACCCCACTCAATGCCATAGT
GCTGGTGGCCACACTGCATTACAAAAAGTTGCGACAGCCCCTCAACTATATTCTGGTCAATGTATCCCTCGGGGGCTTCCTCTTCTGCATCTTCTCTGTCTTCACAGTCTTCATCGCCAGCTGTCACG
GATACTTCCTCTTTGGTCGCCATGTTTGTGCTCTGGAGGCCTTCTTGGGCTCTGTAGCAGGTCTAGTGACAGGATGGTCATTGGCTTTCCTGGCTTTTGAACGCTACGTTGTCATCTGTAAACCCTTC
GGCAGCATCCGCTTCAACTCCAAGCATGCACTGATGGTGGTCCTGGCTACTTGGATTATTGGTATCGGGGTGTCCATCCCACCCTTTTTTGGCTGGAGCAGGTTCATCCCTGAGGGCCTGCAGTGCTC
CTGTGGCCCAGACTGGTACACTGTGGGCACCAAGTATCGAAGCGAGTACTACACCTGGTTCCTCTTCATCTTCTGTTTCATCATTCCTCTTTCCCTCATCTGCTTCTCCTACTCCCAGTTGCTGAGGA
CTCTCAGAGCTGTGGCAGCTCAGCAGCAAGAGTCTGCTACGACACAAAAGGCTGAACGGGAGGTGAGTCATATGGTGGTGGTGATGGTGGGATCCTTCTGTCTCTGCTACGTGCCCTATGCTGCCCTG
GCCATGTACATGGTCAACAATCGGAACCACGGGCTGGACTTACGGCTTGTCACCATCCCCGCCTTCTTTTCCAAGAGCTCCTGTGTCTACAACCCCATCATCTACTGCTTCATGAATAAGCAGTTCCG
GGCTTGCATTCTGGAGATGGTGTGCAGGAAGCCCATGGCAGACGAATCTGACGTGTCTGGCTCTCAGAAAACAGAAGTTTCTACTGTCTCTTCTAGCAAAGTTGGCCCTCACTGAGGCCCCTCAGCTG
GCCTGCTAGCAGCAAACACAACGCCACATTTAAGTATCTACATCTCCACTAGAATCCTAACCATTAACAGGGGAAAGATGGGGAGTGGTGGCACTCTGGTGAGTCACCTTCATTTTCCTGTTACTCTC
TGCCTGTAGCAGGGCCACATGGACCATTTTAACAGTCACAGTTTCTAAGTGGCACTCTCACCTCTGGAGAACTGTGAGAGAAGGGCTGCGTTTCTGGTGTATGGGTAACACTTCCTTTTTTGCTCTTT
TTTTTTTTTTTTCTCCTCCCTGCTGGGGATCTGAGATGATATATCCAGTATTAGAATAAGCTTGGCATGGGGCAGTGCCAAGAAAAGGCAGCAGACACCGGGCACCTGCAGTGAATCGAAGAGCTTCC
TTATGTGGCCTCTCCCAGTTGCTGCAGTCTGGGCTATGGCTGCCAGGATCAGAATGGCCTCACCTCATTTATCTGACACAGAGTTATTCTAGGTGTTCTCCCCTTCATTTGGCTAAATGTATCCATTT
AAAGCTATGCGTTGATTAAAGTTAGTGTCTTAATCTCTTGATGTCCTCAAAATGAATTTGCATGTTTCAGTGGCATTTATAAATCAAGCCCAAGTGCTAAAAACATCTTACTTTATACCCTCCTTACA
CCTGCTGCTCCTGGAAAAGGAGCCCCTCGAAACGAAGAAGTGCGTGTTGAGTTATACGCAAGGAGTGCTGGGTACTGATATCAGGCACTGAAGGTAGGAAAGCCGTAGCTGTGAGAAGGAGCCAGAAA
TCTCAGGAATAGCAAAGGACTAAGTGTGAGGGAGAAATGGAAGTGATAAAAGATCACAGAGATGTATATTTATCTTAGTAACCTGAGGGTTAAAGGCTGGAATACAGTAATTCTTAAAGAGGCCCATT
GATAGGTAAATGGAGTTGGGAAAATTCCTTTTCTGACATTTTATCATAGTACCCTAAACCCATGTCTTTCTTCCTTGGTTCTTTCTTTTTACTGATTTATTTCATGTGCATCAGCGTTCTGCCAGTGT
GTGTGACTATGTGAGTGTTGGATCCCCTGACACTGGAGTTACAGACAGTTGTAAGCTGCTATGTGGGTGCTGGAAATTGAACCCAGGTCCTGAGGAAGAGCAAACAGTGCTCTTAAATGCTGAGCCAT
CTCTTCAGCCTCTTCTTGGTTTCTTGAGACAGAGTCTCTCTATGCAGCCTTGGCTGACCTGGAATATAATCACATTTCCAAGAGAATAAAAGACACATAAGCCCTTAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_031564	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA92458	(Get FASTA)	NCBI Sequence Viewer
	AAB53320	(Get FASTA)	NCBI Sequence Viewer
	AAG17989	(Get FASTA)	NCBI Sequence Viewer
	AAG17990	(Get FASTA)	NCBI Sequence Viewer
	AAH26021	(Get FASTA)	NCBI Sequence Viewer
	AAH58267	(Get FASTA)	NCBI Sequence Viewer
	EDL13781	(Get FASTA)	NCBI Sequence Viewer
	EDL13782	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000079289
	ENSMUSP00000079289.7
GenBank Protein	P51491	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_031564 ⟸ NM_007538

- UniProtKB:

Q548Z8 (UniProtKB/Swiss-Prot), P51491 (UniProtKB/Swiss-Prot), G3UXM0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSGEDDFYLFQNISSVGPWDGPQYHLAPVWAFRLQAAFMGFVFFVGTPLNAIVLVATLHYKKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTGWSLAFLAF
ERYVVICKPFGSIRFNSKHALMVVLATWIIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSEYYTWFLFIFCFIIPLSLICFSYSQLLRTLRAVAAQQQESATTQKAEREVSHMVVVMVGSF
CLCYVPYAALAMYMVNNRNHGLDLRLVTIPAFFSKSSCVYNPIIYCFMNKQFRACILEMVCRKPMADESDVSGSQKTEVSTVSSSKVGPH

hide sequence

Ensembl Acc Id:

ENSMUSP00000133745 ⟸ ENSMUST00000147483

Ensembl Acc Id:

ENSMUSP00000133534 ⟸ ENSMUST00000173653

Ensembl Acc Id:

ENSMUSP00000079289 ⟸ ENSMUST00000080428

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P51491-F1-model_v2	AlphaFold	P51491	1-346	view protein structure

RGD ID:

6839713

Promoter ID:

MM_KWN:45365

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day1, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_4Hour, MEF_B6

Transcripts:

NM_007538, OTTMUST00000054594, OTTMUST00000054595, UC009BDJ.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	6	29,330,061 - 29,331,237 (-)	MPROMDB

RGD ID:

6848015

Promoter ID:

MM_ACW:40714

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

ES_Cell, Lung, MEF_B6

Transcripts:

OPN1SW.FSEP07

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	6	29,338,016 - 29,338,627 (-)	MPROMDB

RGD ID:

6889176

Promoter ID:

EPDNEW_M8039

Type:

initiation region

Name:

Opn1sw_1

Description:

Mus musculus opsin 1 , short-wave-sensitive (color blindness,tritan) , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	6	29,380,475 - 29,380,535	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000058831	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000080428	ENTREZGENE
	ENSMUST00000080428.13	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_opsins	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Opsin	UniProtKB/Swiss-Prot
	Opsin_blue	UniProtKB/Swiss-Prot
	Retinal_BS	UniProtKB/Swiss-Prot
KEGG Report	mmu:12057	UniProtKB/Swiss-Prot
MGD	MGI:99438	ENTREZGENE
NCBI Gene	12057	ENTREZGENE
PANTHER	OPSIN	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Opn1sw	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	OPSIN	UniProtKB/Swiss-Prot
	OPSINBLUE	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
	OPSIN	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	G3UX34_MOUSE	UniProtKB/TrEMBL
	G3UXM0	ENTREZGENE, UniProtKB/TrEMBL
	OPSB_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q548Z8	ENTREZGENE
UniProt Secondary	Q548Z8	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Mammalian Phenotype