Symbol:
BZW2
Name:
basic leucine zipper and W2 domains 2
RGD ID:
731291
HGNC Page
HGNC:18808
Description:
Enables cadherin binding activity. Involved in regulation of translational initiation. Located in cytoplasm.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
5MP1; basic leucine zipper and W2 domain-containing protein 2; eIF5-mimic protein 1; hfb2 protein; HSPC028; MST017; MSTP017
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Bzw2 (basic leucine zipper and W2 domains 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Bzw2 (basic leucine zipper and W2 domains 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Bzw2 (basic leucine zipper and W2 domains 2) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
BZW2 (basic leucine zipper and W2 domains 2) NCBI
Ortholog
Canis lupus familiaris (dog):
BZW2 (basic leucine zipper and W2 domains 2) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bzw2 (basic leucine zipper and W2 domains 2) NCBI
Ortholog
Sus scrofa (pig):
BZW2 (basic leucine zipper and W2 domains 2) HGNC
Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
BZW2 (basic leucine zipper and W2 domains 2) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Bzw2 (basic leucine zipper and W2 domains 2) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Bzw1 (basic leucine zipper and W2 domains 1) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Bzw2 (basic leucine zipper and W2 domains 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Bzw2 (basic leucine zipper and W2 domains 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bzw2 (basic leucine zipper and W2 domains 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
kra
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bzw2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 16,646,181 - 16,706,517 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 16,646,131 - 16,706,523 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 16,685,806 - 16,746,142 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 16,652,284 - 16,712,672 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 16,458,998 - 16,519,387 NCBI Celera 7 16,665,515 - 16,725,894 (+) NCBI Celera Cytogenetic Map 7 p21.1 NCBI HuRef 7 16,572,228 - 16,633,301 (+) NCBI HuRef CHM1_1 7 16,685,482 - 16,745,866 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 16,775,880 - 16,836,213 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 16,738,882 - 16,799,268 (+) NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
BZW2 Human (+)-catechin multiple interactions EXP 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of BZW2 mRNA CTD PMID:24763279 BZW2 Human (+)-schisandrin B multiple interactions ISO Bzw2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BZW2 mRNA] CTD PMID:31150632 BZW2 Human (1->4)-beta-D-glucan multiple interactions ISO Bzw2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BZW2 mRNA CTD PMID:36331819 BZW2 Human 1,2-dimethylhydrazine increases expression ISO Bzw2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of BZW2 mRNA CTD PMID:22206623 BZW2 Human 1,2-dimethylhydrazine multiple interactions ISO Bzw2 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of BZW2 mRNA] CTD PMID:22206623 BZW2 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of BZW2 mRNA CTD PMID:30165855 BZW2 Human 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Bzw2 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 BZW2 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bzw2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BZW2 mRNA CTD PMID:21570461 BZW2 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Bzw2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BZW2 mRNA CTD PMID:33387578 and PMID:34747641 BZW2 Human 2-palmitoylglycerol increases expression EXP 6480464 2-palmitoylglycerol results in increased expression of BZW2 mRNA CTD PMID:37199045 BZW2 Human 4-hydroxyphenyl retinamide decreases expression ISO Bzw2 (Mus musculus) 6480464 Fenretinide results in decreased expression of BZW2 mRNA CTD PMID:28973697 BZW2 Human 6-propyl-2-thiouracil increases expression ISO Bzw2 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of BZW2 mRNA CTD PMID:24780913 and PMID:36843608 BZW2 Human acrolein multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BZW2 mRNA more ... CTD PMID:32699268 and PMID:32845096 BZW2 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of BZW2 gene CTD PMID:27153756 BZW2 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of BZW2 mRNA CTD PMID:23724009 and PMID:33167477 BZW2 Human alpha-pinene multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BZW2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of BZW2 mRNA CTD PMID:32699268 BZW2 Human ammonium chloride affects expression ISO Bzw2 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of BZW2 mRNA CTD PMID:16483693 BZW2 Human antimycin A increases expression EXP 6480464 Antimycin A results in increased expression of BZW2 mRNA CTD PMID:33512557 BZW2 Human arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of BZW2 mRNA CTD PMID:27829220 BZW2 Human atrazine affects methylation ISO Bzw2 (Rattus norvegicus) 6480464 Atrazine affects the methylation of BZW2 gene CTD PMID:35440735 BZW2 Human azoxystrobin increases expression EXP 6480464 azoxystrobin results in increased expression of BZW2 mRNA CTD PMID:33512557 BZW2 Human benzo[a]pyrene decreases expression ISO Bzw2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BZW2 mRNA CTD PMID:21715664 BZW2 Human beta-lapachone increases expression EXP 6480464 beta-lapachone results in increased expression of BZW2 mRNA CTD PMID:38218311 BZW2 Human bis(2-ethylhexyl) phthalate increases expression ISO Bzw2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of BZW2 mRNA CTD PMID:33754040 BZW2 Human bisphenol A increases expression ISO Bzw2 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of BZW2 mRNA CTD PMID:25181051 BZW2 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BZW2 protein CTD PMID:37567409 BZW2 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BZW2 mRNA CTD PMID:29275510 BZW2 Human cadmium dichloride increases expression ISO Bzw2 (Rattus norvegicus) 6480464 Cadmium Chloride results in increased expression of BZW2 mRNA CTD PMID:33453195 BZW2 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of BZW2 mRNA CTD PMID:38568856 BZW2 Human caffeine increases phosphorylation EXP 6480464 Caffeine results in increased phosphorylation of BZW2 protein CTD PMID:35688186 BZW2 Human cantharidin decreases expression ISO Bzw2 (Mus musculus) 6480464 Cantharidin results in decreased expression of BZW2 mRNA CTD PMID:36907384 BZW2 Human carbon nanotube increases expression ISO Bzw2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 BZW2 Human carnosic acid decreases expression ISO Bzw2 (Mus musculus) 6480464 salvin results in decreased expression of BZW2 protein CTD PMID:35926579 BZW2 Human choline multiple interactions ISO Bzw2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BZW2 mRNA CTD PMID:20938992 BZW2 Human chromium(6+) affects expression ISO Bzw2 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of BZW2 mRNA CTD PMID:28472532 BZW2 Human copper atom multiple interactions ISO Bzw2 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of BZW2 mRNA CTD PMID:15467011 BZW2 Human copper(0) multiple interactions ISO Bzw2 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of BZW2 mRNA CTD PMID:15467011 BZW2 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of BZW2 mRNA CTD PMID:25562108 BZW2 Human DDE increases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of BZW2 mRNA CTD PMID:38568856 BZW2 Human diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of BZW2 mRNA CTD PMID:27829220 BZW2 Human diazinon increases methylation EXP 6480464 Diazinon results in increased methylation of BZW2 gene CTD PMID:22964155 BZW2 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of BZW2 mRNA CTD PMID:29803840 BZW2 Human enzyme inhibitor multiple interactions EXP 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of BZW2 protein CTD PMID:23301498 BZW2 Human ethyl methanesulfonate decreases expression EXP 6480464 Ethyl Methanesulfonate results in decreased expression of BZW2 mRNA CTD PMID:23649840 BZW2 Human folic acid multiple interactions ISO Bzw2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BZW2 mRNA more ... CTD PMID:20938992 and PMID:22206623 BZW2 Human FR900359 increases phosphorylation EXP 6480464 FR900359 results in increased phosphorylation of BZW2 protein CTD PMID:37730182 BZW2 Human indole-3-methanol affects expression ISO Bzw2 (Rattus norvegicus) 6480464 indole-3-carbinol affects the expression of BZW2 mRNA CTD PMID:21396975 BZW2 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of BZW2 protein CTD PMID:32959892 BZW2 Human L-methionine multiple interactions ISO Bzw2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BZW2 mRNA CTD PMID:20938992 BZW2 Human methyl methanesulfonate decreases expression EXP 6480464 Methyl Methanesulfonate results in decreased expression of BZW2 mRNA CTD PMID:23649840 BZW2 Human monosodium L-glutamate increases expression ISO Bzw2 (Mus musculus) 6480464 Sodium Glutamate results in increased expression of BZW2 mRNA CTD PMID:22078008 BZW2 Human oxaliplatin multiple interactions ISO Bzw2 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of BZW2 mRNA CTD PMID:25729387 BZW2 Human ozone multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BZW2 mRNA more ... CTD PMID:32699268 more ... BZW2 Human ozone multiple interactions ISO Bzw2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of BZW2 mRNA CTD PMID:34911549 BZW2 Human paracetamol increases expression ISO Bzw2 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of BZW2 mRNA CTD PMID:32479839 BZW2 Human paracetamol decreases expression ISO Bzw2 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of BZW2 mRNA CTD PMID:33387578 BZW2 Human paraquat increases expression ISO Bzw2 (Rattus norvegicus) 6480464 Paraquat results in increased expression of BZW2 mRNA CTD PMID:32680482 BZW2 Human perfluorohexanesulfonic acid increases expression ISO Bzw2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of BZW2 mRNA CTD PMID:37995155 BZW2 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Bzw2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BZW2 mRNA CTD PMID:36331819 BZW2 Human PhIP increases expression ISO Bzw2 (Rattus norvegicus) 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of BZW2 mRNA CTD PMID:15215175 BZW2 Human picoxystrobin increases expression EXP 6480464 picoxystrobin results in increased expression of BZW2 mRNA CTD PMID:33512557 BZW2 Human pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of BZW2 mRNA CTD PMID:19710929 BZW2 Human pirinixic acid multiple interactions ISO Bzw2 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of BZW2 mRNA CTD PMID:19710929 BZW2 Human progesterone affects expression ISO Bzw2 (Mus musculus) 6480464 Progesterone affects the expression of BZW2 mRNA CTD PMID:17251523 BZW2 Human rotenone increases expression ISO Bzw2 (Mus musculus) 6480464 Rotenone results in increased expression of BZW2 mRNA CTD PMID:32937126 BZW2 Human silicon dioxide increases expression ISO Bzw2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of BZW2 mRNA CTD PMID:19073995 BZW2 Human silver atom decreases expression ISO Bzw2 (Mus musculus) 6480464 Silver results in decreased expression of BZW2 mRNA CTD PMID:27131904 BZW2 Human silver(0) decreases expression ISO Bzw2 (Mus musculus) 6480464 Silver results in decreased expression of BZW2 mRNA CTD PMID:27131904 BZW2 Human sodium arsenate increases expression ISO Bzw2 (Mus musculus) 6480464 sodium arsenate results in increased expression of BZW2 mRNA CTD PMID:30953684 BZW2 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of BZW2 mRNA CTD PMID:38568856 BZW2 Human sodium dichromate decreases expression ISO Bzw2 (Mus musculus) 6480464 sodium bichromate results in decreased expression of BZW2 mRNA CTD PMID:31558096 BZW2 Human sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of BZW2 mRNA CTD PMID:11093808 BZW2 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of BZW2 mRNA CTD PMID:31533062 BZW2 Human temozolomide increases expression EXP 6480464 Temozolomide results in increased expression of BZW2 mRNA CTD PMID:31758290 BZW2 Human tetrachloromethane increases expression ISO Bzw2 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of BZW2 mRNA CTD PMID:31150632 BZW2 Human tetrachloromethane multiple interactions ISO Bzw2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BZW2 mRNA] CTD PMID:31150632 BZW2 Human thioacetamide increases expression ISO Bzw2 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of BZW2 mRNA CTD PMID:34492290 BZW2 Human titanium dioxide decreases methylation ISO Bzw2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of BZW2 gene CTD PMID:35295148 BZW2 Human topotecan multiple interactions ISO Bzw2 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of BZW2 mRNA CTD PMID:25729387 BZW2 Human trichloroethene decreases expression ISO Bzw2 (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of BZW2 mRNA CTD PMID:33387578 BZW2 Human triclosan decreases expression EXP 6480464 Triclosan results in decreased expression of BZW2 mRNA CTD PMID:30510588 BZW2 Human trimellitic anhydride increases expression ISO Bzw2 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of BZW2 mRNA CTD PMID:19042947 BZW2 Human valproic acid affects expression ISO Bzw2 (Mus musculus) 6480464 Valproic Acid affects the expression of BZW2 mRNA CTD PMID:17292431 BZW2 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of BZW2 mRNA CTD PMID:23179753 and PMID:29154799 BZW2 Human valproic acid decreases methylation EXP 6480464 Valproic Acid results in decreased methylation of BZW2 gene CTD PMID:29154799 BZW2 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of BZW2 mRNA CTD PMID:25979313
(+)-catechin (EXP) (+)-schisandrin B (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-palmitoylglycerol (EXP) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (ISO) acrolein (EXP) aflatoxin B1 (EXP) all-trans-retinoic acid (EXP) alpha-pinene (EXP) ammonium chloride (ISO) antimycin A (EXP) arsenous acid (EXP) atrazine (ISO) azoxystrobin (EXP) benzo[a]pyrene (ISO) beta-lapachone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (EXP,ISO) caffeine (EXP) cantharidin (ISO) carbon nanotube (ISO) carnosic acid (ISO) choline (ISO) chromium(6+) (ISO) copper atom (ISO) copper(0) (ISO) cyclosporin A (EXP) DDE (EXP) diarsenic trioxide (EXP) diazinon (EXP) doxorubicin (EXP) enzyme inhibitor (EXP) ethyl methanesulfonate (EXP) folic acid (ISO) FR900359 (EXP) indole-3-methanol (ISO) ivermectin (EXP) L-methionine (ISO) methyl methanesulfonate (EXP) monosodium L-glutamate (ISO) oxaliplatin (ISO) ozone (EXP,ISO) paracetamol (ISO) paraquat (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) PhIP (ISO) picoxystrobin (EXP) pirinixic acid (EXP,ISO) progesterone (ISO) rotenone (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (EXP) sodium dichromate (ISO) sulindac (EXP) sunitinib (EXP) temozolomide (EXP) tetrachloromethane (ISO) thioacetamide (ISO) titanium dioxide (ISO) topotecan (ISO) trichloroethene (ISO) triclosan (EXP) trimellitic anhydride (ISO) valproic acid (EXP,ISO)
BZW2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 16,646,181 - 16,706,517 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 16,646,131 - 16,706,523 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 16,685,806 - 16,746,142 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 16,652,284 - 16,712,672 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 16,458,998 - 16,519,387 NCBI Celera 7 16,665,515 - 16,725,894 (+) NCBI Celera Cytogenetic Map 7 p21.1 NCBI HuRef 7 16,572,228 - 16,633,301 (+) NCBI HuRef CHM1_1 7 16,685,482 - 16,745,866 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 16,775,880 - 16,836,213 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 16,738,882 - 16,799,268 (+) NCBI
Bzw2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 36,141,834 - 36,206,922 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 36,141,834 - 36,208,079 (-) Ensembl GRCm39 Ensembl GRCm38 12 36,091,835 - 36,156,841 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 36,091,835 - 36,158,080 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 36,818,422 - 36,883,412 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 36,602,105 - 36,667,010 (-) NCBI MGSCv36 mm8 Celera 12 37,545,819 - 37,611,090 (-) NCBI Celera Cytogenetic Map 12 A3 NCBI cM Map 12 16.42 NCBI
Bzw2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 58,555,362 - 58,615,921 (-) NCBI GRCr8 mRatBN7.2 6 52,828,069 - 52,888,599 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 52,827,661 - 52,888,628 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 53,120,683 - 53,181,220 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 53,435,550 - 53,496,081 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 52,898,334 - 52,959,820 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 55,586,754 - 55,647,650 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 55,586,346 - 55,647,665 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 65,200,715 - 65,261,842 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 54,817,673 - 54,881,310 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 54,820,397 - 54,884,464 (-) NCBI Celera 6 51,973,274 - 52,031,219 (-) NCBI Celera Cytogenetic Map 6 q16 NCBI
Bzw2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955410 19,833,008 - 19,878,691 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955410 19,833,008 - 19,874,647 (+) NCBI ChiLan1.0 ChiLan1.0
BZW2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 21,480,609 - 21,541,061 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 69,805,394 - 69,865,789 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 17,302,322 - 17,362,737 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 16,628,679 - 16,688,982 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 16,628,679 - 16,688,982 (+) Ensembl panpan1.1 panPan2
BZW2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 31,154,285 - 31,217,193 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 31,153,659 - 31,216,911 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 30,675,507 - 30,738,414 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 31,074,256 - 31,137,402 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 31,073,635 - 31,140,004 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 31,176,749 - 31,239,826 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 30,889,237 - 30,952,274 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 31,201,867 - 31,264,960 (+) NCBI UU_Cfam_GSD_1.0
Bzw2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 75,484,939 - 75,540,502 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936546 3,160,004 - 3,216,331 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936546 3,160,047 - 3,215,591 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BZW2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 85,886,158 - 85,947,410 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 85,887,801 - 85,947,414 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 94,778,684 - 94,817,951 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BZW2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 41,409,358 - 41,469,833 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 41,409,364 - 41,469,662 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 63,040,726 - 63,101,076 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bzw2
.
Predicted Target Of
Count of predictions: 2425 Count of miRNA genes: 863 Interacting mature miRNAs: 985 Transcripts: ENST00000258761, ENST00000405202, ENST00000407633, ENST00000415365, ENST00000430000, ENST00000432311, ENST00000433922, ENST00000436868, ENST00000437745, ENST00000438834, ENST00000446596, ENST00000452975, ENST00000480517 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
406968512 GWAS617488_H reticulocyte count QTL GWAS617488 (human) 5e-29 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16691417 16691418 Human 406964419 GWAS613395_H reticulocyte count QTL GWAS613395 (human) 2e-25 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16691417 16691418 Human 406964418 GWAS613394_H reticulocyte count QTL GWAS613394 (human) 9e-24 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16660352 16660353 Human 597302302 GWAS1398376_H mean corpuscular hemoglobin QTL GWAS1398376 (human) 2e-11 mean corpuscular hemoglobin mean corpuscular hemoglobin (CMO:0000290) 7 16673961 16673962 Human 406988101 GWAS637077_H reticulocyte count QTL GWAS637077 (human) 3e-25 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16660352 16660353 Human 597107615 GWAS1203689_H reticulocyte count QTL GWAS1203689 (human) 3e-19 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16691417 16691418 Human 597107614 GWAS1203688_H reticulocyte count QTL GWAS1203688 (human) 2e-23 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16660352 16660353 Human 597314071 GWAS1410145_H diastolic blood pressure QTL GWAS1410145 (human) 1e-09 diastolic blood pressure diastolic blood pressure (CMO:0000005) 7 16685591 16685592 Human 406960335 GWAS609311_H reticulocyte count QTL GWAS609311 (human) 2e-27 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16691417 16691418 Human 406960334 GWAS609310_H reticulocyte count QTL GWAS609310 (human) 5e-26 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16660352 16660353 Human 597084548 GWAS1180622_H reticulocyte measurement QTL GWAS1180622 (human) 9e-17 reticulocyte morphology trait (VT:0002424) red blood cell measurement (CMO:0001356) 7 16691417 16691418 Human 1643402 BMD2_H Bone mineral density QTL 2 (human) 2.69 0.0002 Bone mineral density 7 1 22435431 Human 597084547 GWAS1180621_H reticulocyte measurement QTL GWAS1180621 (human) 1e-11 reticulocyte morphology trait (VT:0002424) red blood cell measurement (CMO:0001356) 7 16660352 16660353 Human 407382869 GWAS1031845_H obsolete_red blood cell distribution width QTL GWAS1031845 (human) 7e-15 obsolete_red blood cell distribution width 7 16660352 16660353 Human 597270148 GWAS1366222_H diastolic blood pressure QTL GWAS1366222 (human) 3e-09 diastolic blood pressure diastolic blood pressure (CMO:0000005) 7 16680292 16680293 Human 407111770 GWAS760746_H mean corpuscular hemoglobin QTL GWAS760746 (human) 4e-14 mean corpuscular hemoglobin mean corpuscular hemoglobin (CMO:0000290) 7 16660352 16660353 Human 407385833 GWAS1034809_H obsolete_red blood cell distribution width QTL GWAS1034809 (human) 2e-14 obsolete_red blood cell distribution width 7 16660352 16660353 Human 596977080 GWAS1096599_H Red cell distribution width QTL GWAS1096599 (human) 6e-16 Red cell distribution width 7 16660352 16660353 Human 406996332 GWAS645308_H mean corpuscular hemoglobin concentration QTL GWAS645308 (human) 6e-14 mean corpuscular hemoglobin concentration mean corpuscular hemoglobin concentration (CMO:0000291) 7 16691417 16691418 Human 597213366 GWAS1309440_H velopharyngeal dysfunction QTL GWAS1309440 (human) 0.000001 velopharyngeal dysfunction 7 16696157 16696158 Human 407083628 GWAS732604_H obsolete_red blood cell distribution width QTL GWAS732604 (human) 6e-16 obsolete_red blood cell distribution width 7 16660352 16660353 Human 597107495 GWAS1203569_H reticulocyte measurement QTL GWAS1203569 (human) 6e-26 reticulocyte morphology trait (VT:0002424) red blood cell measurement (CMO:0001356) 7 16660352 16660353 Human 597456812 GWAS1552886_H diastolic blood pressure QTL GWAS1552886 (human) 4e-08 diastolic blood pressure diastolic blood pressure (CMO:0000005) 7 16680292 16680293 Human 407124851 GWAS773827_H Alzheimer disease QTL GWAS773827 (human) 6e-11 Alzheimer disease 7 16668236 16668237 Human 596951594 GWAS1071113_H Red cell distribution width QTL GWAS1071113 (human) 8e-16 Red cell distribution width 7 16660352 16660353 Human 597107496 GWAS1203570_H reticulocyte measurement QTL GWAS1203570 (human) 2e-21 reticulocyte morphology trait (VT:0002424) red blood cell measurement (CMO:0001356) 7 16691417 16691418 Human 597079767 GWAS1175841_H Red cell distribution width QTL GWAS1175841 (human) 7e-15 Red cell distribution width red blood cell distribution width- standard deviation (CMO:0003232) 7 16660352 16660353 Human 597128405 GWAS1224479_H inflammatory bowel disease QTL GWAS1224479 (human) 0.000004 inflammatory bowel disease 7 16666924 16666925 Human 597088347 GWAS1184421_H Red cell distribution width QTL GWAS1184421 (human) 8e-16 Red cell distribution width red blood cell distribution width- standard deviation (CMO:0003232) 7 16660352 16660353 Human 406977039 GWAS626015_H reticulocyte count QTL GWAS626015 (human) 1e-27 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16691417 16691418 Human 406977042 GWAS626018_H reticulocyte count QTL GWAS626018 (human) 8e-26 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16660352 16660353 Human 596951360 GWAS1070879_H dementia QTL GWAS1070879 (human) 0.000003 dementia 7 16690212 16690213 Human 597105217 GWAS1201291_H Red cell distribution width QTL GWAS1201291 (human) 6e-16 Red cell distribution width red blood cell distribution width- standard deviation (CMO:0003232) 7 16660352 16660353 Human 596967875 GWAS1087394_H diastolic blood pressure QTL GWAS1087394 (human) 1e-09 diastolic blood pressure 7 16685591 16685592 Human 406993826 GWAS642802_H reticulocyte measurement QTL GWAS642802 (human) 2e-27 reticulocyte morphology trait (VT:0002424) red blood cell measurement (CMO:0001356) 7 16660352 16660353 Human 406993827 GWAS642803_H reticulocyte measurement QTL GWAS642803 (human) 6e-27 reticulocyte morphology trait (VT:0002424) red blood cell measurement (CMO:0001356) 7 16691417 16691418 Human 597126259 GWAS1222333_H ulcerative colitis QTL GWAS1222333 (human) 0.0000003 ulcerative colitis 7 16666924 16666925 Human 407385773 GWAS1034749_H obsolete_red blood cell distribution width QTL GWAS1034749 (human) 8e-16 obsolete_red blood cell distribution width 7 16660352 16660353 Human 406975268 GWAS624244_H reticulocyte count QTL GWAS624244 (human) 2e-16 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16660352 16660353 Human 1643391 BW322_H Body weight QTL 322 (human) 2.69 0.0002 Body fat amount 7 1 22435431 Human 596952946 GWAS1072465_H Red cell distribution width QTL GWAS1072465 (human) 7e-15 Red cell distribution width 7 16660352 16660353 Human 596958451 GWAS1077970_H Red cell distribution width QTL GWAS1077970 (human) 2e-14 Red cell distribution width 7 16660352 16660353 Human 406988330 GWAS637306_H mean corpuscular hemoglobin concentration QTL GWAS637306 (human) 1e-13 mean corpuscular hemoglobin mean corpuscular hemoglobin (CMO:0000290) 7 16660352 16660353 Human 597180913 GWAS1276987_H pyruvate measurement QTL GWAS1276987 (human) 4e-08 pyruvate measurement blood pyruvate level (CMO:0002422) 7 16655242 16655243 Human 597019132 GWAS1115206_H smoking status measurement, systolic blood pressure QTL GWAS1115206 (human) 7e-10 smoking status measurement, systolic blood pressure systolic blood pressure (CMO:0000004) 7 16670980 16670981 Human 597052794 GWAS1148868_H Red cell distribution width QTL GWAS1148868 (human) 2e-14 Red cell distribution width red blood cell distribution width- standard deviation (CMO:0003232) 7 16660352 16660353 Human 1643247 BW130_H Body Weight QTL 130 (human) 1.28 0.008 Body weight body mass index 7 1 17453493 Human 597159021 GWAS1255095_H dementia QTL GWAS1255095 (human) 0.000003 dementia 7 16690212 16690213 Human 406968511 GWAS617487_H reticulocyte count QTL GWAS617487 (human) 1e-27 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 7 16660352 16660353 Human 597019242 GWAS1115316_H smoking status measurement, diastolic blood pressure QTL GWAS1115316 (human) 0.000003 smoking status measurement, diastolic blood pressure diastolic blood pressure (CMO:0000005) 7 16670980 16670981 Human
SHGC-55976
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 16,745,838 - 16,746,109 UniSTS GRCh37 Build 36 7 16,712,363 - 16,712,634 RGD NCBI36 Celera 7 16,725,584 - 16,725,855 RGD Cytogenetic Map 7 p21.1 UniSTS HuRef 7 16,632,991 - 16,633,262 UniSTS CRA_TCAGchr7v2 7 16,798,958 - 16,799,229 UniSTS GeneMap99-GB4 RH Map 7 81.11 UniSTS Whitehead-RH Map 7 57.9 UniSTS NCBI RH Map 7 236.6 UniSTS
BZW2_9566
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 16,745,730 - 16,746,177 UniSTS GRCh37 Build 36 7 16,712,255 - 16,712,702 RGD NCBI36 Celera 7 16,725,476 - 16,725,923 RGD HuRef 7 16,632,883 - 16,633,330 UniSTS CRA_TCAGchr7v2 7 16,798,850 - 16,799,297 UniSTS
D7S1766
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 16,726,839 - 16,727,043 UniSTS GRCh37 Build 36 7 16,693,364 - 16,693,568 RGD NCBI36 Celera 7 16,706,587 - 16,706,791 RGD Cytogenetic Map 7 p21.1 UniSTS HuRef 7 16,613,994 - 16,614,198 UniSTS CRA_TCAGchr7v2 7 16,779,961 - 16,780,165 UniSTS Whitehead-YAC Contig Map 7 UniSTS
GDB:1318220
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 16,734,853 - 16,735,058 UniSTS GRCh37 Build 36 7 16,701,378 - 16,701,583 RGD NCBI36 Celera 7 16,714,599 - 16,714,804 RGD Cytogenetic Map 7 p21.1 UniSTS HuRef 7 16,622,006 - 16,622,211 UniSTS CRA_TCAGchr7v2 7 16,787,973 - 16,788,178 UniSTS
RH36275
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 16,745,682 - 16,745,782 UniSTS GRCh37 Build 36 7 16,712,207 - 16,712,307 RGD NCBI36 Celera 7 16,725,428 - 16,725,528 RGD Cytogenetic Map 7 p21.1 UniSTS HuRef 7 16,632,835 - 16,632,935 UniSTS CRA_TCAGchr7v2 7 16,798,802 - 16,798,902 UniSTS GeneMap99-GB4 RH Map 7 105.01 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1949
465
2270
7304
6470
53
3734
1
852
1743
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000258761 ⟹ ENSP00000258761
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,646,181 - 16,706,517 (+) Ensembl
Ensembl Acc Id:
ENST00000405202 ⟹ ENSP00000385577
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,646,195 - 16,706,481 (+) Ensembl
Ensembl Acc Id:
ENST00000407633 ⟹ ENSP00000384617
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,688,525 - 16,706,197 (+) Ensembl
Ensembl Acc Id:
ENST00000415365 ⟹ ENSP00000403481
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,646,131 - 16,704,662 (+) Ensembl
Ensembl Acc Id:
ENST00000430000 ⟹ ENSP00000416531
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,662,133 - 16,685,987 (+) Ensembl
Ensembl Acc Id:
ENST00000432311
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,646,160 - 16,697,047 (+) Ensembl
Ensembl Acc Id:
ENST00000433922 ⟹ ENSP00000397249
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,646,134 - 16,706,512 (+) Ensembl
Ensembl Acc Id:
ENST00000436868 ⟹ ENSP00000389183
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,646,174 - 16,706,509 (+) Ensembl
Ensembl Acc Id:
ENST00000437745 ⟹ ENSP00000406395
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,646,160 - 16,706,523 (+) Ensembl
Ensembl Acc Id:
ENST00000438834 ⟹ ENSP00000415924
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,661,272 - 16,689,881 (+) Ensembl
Ensembl Acc Id:
ENST00000446596 ⟹ ENSP00000412750
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,661,223 - 16,695,004 (+) Ensembl
Ensembl Acc Id:
ENST00000452975 ⟹ ENSP00000411715
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,661,227 - 16,706,512 (+) Ensembl
Ensembl Acc Id:
ENST00000480517
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,661,214 - 16,687,554 (+) Ensembl
Ensembl Acc Id:
ENST00000630952 ⟹ ENSP00000486454
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 16,646,134 - 16,706,523 (+) Ensembl
RefSeq Acc Id:
NM_001159767 ⟹ NP_001153239
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 7 16,646,181 - 16,706,517 (+) NCBI GRCh37 7 16,685,759 - 16,746,148 (+) RGD Celera 7 16,665,515 - 16,725,894 (+) RGD HuRef 7 16,572,228 - 16,633,301 (+) RGD CHM1_1 7 16,685,482 - 16,745,866 (+) NCBI T2T-CHM13v2.0 7 16,775,880 - 16,836,213 (+) NCBI CRA_TCAGchr7v2 7 16,738,882 - 16,799,268 (+) ENTREZGENE
Sequence:
ACTCCTCCATTGTCTGCCGCCACTGCTGCTGCTGCTGCTGCTGCCGCTGCTGCTGCACGAATCGCCGCAGCCCCCAGCCTTGCGCGTCGTCGCTACCTCCTCGGACAGGTGAGAAGCAGCCCAGAAAT
hide sequence
RefSeq Acc Id:
NM_001362717 ⟹ NP_001349646
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 7 16,661,214 - 16,706,517 (+) NCBI T2T-CHM13v2.0 7 16,790,908 - 16,836,213 (+) NCBI
Sequence:
AGACAGGAGCAGTCATTCCCTTGTAGGGACAACTAGAAGAAATTTTATGAATAAGCATCAGAAG
hide sequence
RefSeq Acc Id:
NM_001362718 ⟹ NP_001349647
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 7 16,646,181 - 16,706,517 (+) NCBI T2T-CHM13v2.0 7 16,775,880 - 16,836,213 (+) NCBI
Sequence:
ACTCCTCCATTGTCTGCCGCCACTGCTGCTGCTGCTGCTGCTGCCGCTGCTGCTGCACGAATCG
hide sequence
RefSeq Acc Id:
NM_001362719 ⟹ NP_001349648
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 7 16,661,214 - 16,706,517 (+) NCBI T2T-CHM13v2.0 7 16,790,908 - 16,836,213 (+) NCBI
Sequence:
AGACAGGAGCAGTCATTCCCTTGTAGGGACAACTAGAAGAAATTTTATGAATAAGCATCAGAAGCCAGTGCTAACAGGCCAGCGGTTCAAAACTCGGAAAAGGGATGAAAAAGAGAAATTCGAACCCA
hide sequence
RefSeq Acc Id:
NM_014038 ⟹ NP_054757
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 7 16,646,181 - 16,706,517 (+) NCBI GRCh37 7 16,685,759 - 16,746,148 (+) RGD Build 36 7 16,652,284 - 16,712,672 (+) NCBI Archive Celera 7 16,665,515 - 16,725,894 (+) RGD HuRef 7 16,572,228 - 16,633,301 (+) RGD CHM1_1 7 16,685,482 - 16,745,866 (+) NCBI T2T-CHM13v2.0 7 16,775,880 - 16,836,213 (+) NCBI CRA_TCAGchr7v2 7 16,738,882 - 16,799,268 (+) ENTREZGENE
Sequence:
ACTCCTCCATTGTCTGCCGCCACTGCTGCTGCTGCTGCTGCTGCCGCTGCTGCTGCACGAATCG
hide sequence
RefSeq Acc Id:
XM_006715707 ⟹ XP_006715770
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 7 16,661,214 - 16,706,517 (+) NCBI
Sequence:
ATAGTGTAGCATGAAGAGCTAAATTTAGAGGGAAGTGGGGCCTCTGCTCCAAATAGTAACAGCTAAAGGATAGACACTCTTGGAGAGCAGAATATCTTTATTTAGTCTGTCACCACCAGTGGAAATTT
hide sequence
RefSeq Acc Id:
XM_006715708 ⟹ XP_006715771
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 7 16,661,214 - 16,706,517 (+) NCBI
Sequence:
AGTTTCTTTCCAAAATGGAGAGAACTAAAGAAGAGTCCCAGAAATTTTATGAATAAGCATCAGA
hide sequence
RefSeq Acc Id:
XM_054357986 ⟹ XP_054213961
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 7 16,790,965 - 16,836,213 (+) NCBI
RefSeq Acc Id:
NP_054757 ⟸ NM_014038
- Peptide Label:
isoform 1
- UniProtKB:
Q96JW5 (UniProtKB/Swiss-Prot), Q3B779 (UniProtKB/Swiss-Prot), A4D123 (UniProtKB/Swiss-Prot), Q9H3F7 (UniProtKB/Swiss-Prot), Q9Y6E2 (UniProtKB/Swiss-Prot), B3KM68 (UniProtKB/TrEMBL)
- Sequence:
MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKA
hide sequence
RefSeq Acc Id:
NP_001153239 ⟸ NM_001159767
- Peptide Label:
isoform 1
- UniProtKB:
Q96JW5 (UniProtKB/Swiss-Prot), Q3B779 (UniProtKB/Swiss-Prot), A4D123 (UniProtKB/Swiss-Prot), Q9H3F7 (UniProtKB/Swiss-Prot), Q9Y6E2 (UniProtKB/Swiss-Prot), B3KM68 (UniProtKB/TrEMBL)
- Sequence:
MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRY
hide sequence
RefSeq Acc Id:
XP_006715771 ⟸ XM_006715708
- Peptide Label:
isoform X1
- UniProtKB:
Q96JW5 (UniProtKB/Swiss-Prot), Q3B779 (UniProtKB/Swiss-Prot), A4D123 (UniProtKB/Swiss-Prot), Q9H3F7 (UniProtKB/Swiss-Prot), Q9Y6E2 (UniProtKB/Swiss-Prot), B3KM68 (UniProtKB/TrEMBL)
- Sequence:
MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKA
hide sequence
RefSeq Acc Id:
XP_006715770 ⟸ XM_006715707
- Peptide Label:
isoform X1
- UniProtKB:
Q96JW5 (UniProtKB/Swiss-Prot), Q3B779 (UniProtKB/Swiss-Prot), A4D123 (UniProtKB/Swiss-Prot), Q9H3F7 (UniProtKB/Swiss-Prot), Q9Y6E2 (UniProtKB/Swiss-Prot), B3KM68 (UniProtKB/TrEMBL)
- Sequence:
MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRY
hide sequence
RefSeq Acc Id:
NP_001349647 ⟸ NM_001362718
- Peptide Label:
isoform 2
- UniProtKB:
B5MCE7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001349646 ⟸ NM_001362717
- Peptide Label:
isoform 1
- UniProtKB:
Q9Y6E2 (UniProtKB/Swiss-Prot), Q96JW5 (UniProtKB/Swiss-Prot), Q3B779 (UniProtKB/Swiss-Prot), A4D123 (UniProtKB/Swiss-Prot), Q9H3F7 (UniProtKB/Swiss-Prot), B3KM68 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001349648 ⟸ NM_001362719
- Peptide Label:
isoform 2
- UniProtKB:
B5MCE7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSP00000406395 ⟸ ENST00000437745
Ensembl Acc Id:
ENSP00000415924 ⟸ ENST00000438834
Ensembl Acc Id:
ENSP00000411715 ⟸ ENST00000452975
Ensembl Acc Id:
ENSP00000258761 ⟸ ENST00000258761
Ensembl Acc Id:
ENSP00000403481 ⟸ ENST00000415365
Ensembl Acc Id:
ENSP00000416531 ⟸ ENST00000430000
Ensembl Acc Id:
ENSP00000385577 ⟸ ENST00000405202
Ensembl Acc Id:
ENSP00000412750 ⟸ ENST00000446596
Ensembl Acc Id:
ENSP00000384617 ⟸ ENST00000407633
Ensembl Acc Id:
ENSP00000397249 ⟸ ENST00000433922
Ensembl Acc Id:
ENSP00000486454 ⟸ ENST00000630952
Ensembl Acc Id:
ENSP00000389183 ⟸ ENST00000436868
RefSeq Acc Id:
XP_054213961 ⟸ XM_054357986
- Peptide Label:
isoform X1
- UniProtKB:
Q9Y6E2 (UniProtKB/Swiss-Prot), Q96JW5 (UniProtKB/Swiss-Prot), Q3B779 (UniProtKB/Swiss-Prot), A4D123 (UniProtKB/Swiss-Prot), Q9H3F7 (UniProtKB/Swiss-Prot), B3KM68 (UniProtKB/TrEMBL)
RGD ID: 7209989 Promoter ID: EPDNEW_H10738 Type: initiation region Name: BZW2_1 Description: basic leucine zipper and W2 domains 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H10739 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 7 16,646,181 - 16,646,241 EPDNEW
RGD ID: 6805293 Promoter ID: HG_KWN:56400 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: NM_001159767, NR_027624, OTTHUMT00000207600, OTTHUMT00000253256, OTTHUMT00000326246, OTTHUMT00000326247, OTTHUMT00000326301, OTTHUMT00000326371, OTTHUMT00000326372, OTTHUMT00000326378, UC003STK.1, UC010KTZ.1 Position: Human Assembly Chr Position (strand) Source Build 36 7 16,650,851 - 16,652,442 (+) MPROMDB
RGD ID: 6853120 Promoter ID: EP74381 Type: initiation region Name: HS_BZW2_1 Description: Basic leucine zipper and W2 domains 2. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: alternative promoter #1 of 2; 5' exon 1; site 1.; see alsoEP74382 Experiment Methods: Mammalian gene collection (MGC) full-length cDNA cloning Position: Human Assembly Chr Position (strand) Source Build 36 7 16,652,295 - 16,652,355 EPD
RGD ID: 6853122 Promoter ID: EP74382 Type: initiation region Name: HS_BZW2_2 Description: Basic leucine zipper and W2 domains 2. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: alternative promoter #2 of 2; 5' exon 1; site 2; major promoter.; see alsoEP74381 Experiment Methods: Mammalian gene collection (MGC) full-length cDNA cloning Position: Human Assembly Chr Position (strand) Source Build 36 7 16,652,349 - 16,652,409 EPD
RGD ID: 7209985 Promoter ID: EPDNEW_H10739 Type: initiation region Name: BZW2_2 Description: basic leucine zipper and W2 domains 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H10738 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 7 16,661,228 - 16,661,288 EPDNEW
RGD ID: 6805960 Promoter ID: HG_KWN:56401 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562 Transcripts: OTTHUMT00000326300, OTTHUMT00000326374, OTTHUMT00000326375, UC003STO.1 Position: Human Assembly Chr Position (strand) Source Build 36 7 16,667,196 - 16,667,696 (+) MPROMDB
RGD ID: 6805288 Promoter ID: HG_KWN:56402 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3 Transcripts: OTTHUMT00000326376 Position: Human Assembly Chr Position (strand) Source Build 36 7 16,667,281 - 16,667,781 (+) MPROMDB
