Symbol:
Gmfb
Name:
glia maturation factor, beta
RGD ID:
70910
Description:
Predicted to enable Arp2/3 complex binding activity. Predicted to be involved in actin filament debranching and negative regulation of Arp2/3 complex-mediated actin nucleation. Predicted to act upstream of or within learning and locomotory behavior. Predicted to be active in cortical actin cytoskeleton. Orthologous to human GMFB (glia maturation factor beta); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
DNA for thyroid hormone receptor binding site (276bp); glia maturation factor beta; GMF-beta; MGC93372
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GMFB (glia maturation factor beta) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther
Mus musculus (house mouse):
Gmfb (glia maturation factor, beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gmfb (glia maturation factor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GMFB (glia maturation factor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GMFB (glia maturation factor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gmfb (glia maturation factor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GMFB (glia maturation factor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GMFB (glia maturation factor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gmfb (glia maturation factor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GMFG (glia maturation factor gamma) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
GMFB (glia maturation factor beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Gmfb (glia maturation factor, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gmfb (glia maturation factor, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
AIM7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
GMF
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
Y50D7A.10
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gmfb
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 22,549,705 - 22,560,125 (-) NCBI GRCr8 mRatBN7.2 15 20,069,923 - 20,081,005 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 20,067,263 - 20,080,331 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 22,850,667 - 22,860,918 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 23,808,661 - 23,818,912 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 22,058,939 - 22,069,311 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 23,597,846 - 23,611,541 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 23,601,368 - 23,606,634 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 27,541,333 - 27,555,033 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 22,664,728 - 22,675,100 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 22,680,429 - 22,690,800 (-) NCBI Celera 15 20,468,408 - 20,478,698 (-) NCBI Celera Cytogenetic Map 15 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gmfb Rat (-)-demecolcine increases expression ISO GMFB (Homo sapiens) 6480464 Demecolcine results in increased expression of GMFB mRNA CTD PMID:23649840 Gmfb Rat (1->4)-beta-D-glucan multiple interactions ISO Gmfb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GMFB mRNA CTD PMID:36331819 Gmfb Rat (S)-nicotine multiple interactions ISO Gmfb (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Gmfb Rat 1,2-dimethylhydrazine multiple interactions ISO Gmfb (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of GMFB mRNA] CTD PMID:22206623 Gmfb Rat 1,2-dimethylhydrazine decreases expression ISO Gmfb (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GMFB mRNA CTD PMID:22206623 Gmfb Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Gmfb (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Gmfb Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Gmfb (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Gmfb Rat 17beta-estradiol decreases expression ISO Gmfb (Mus musculus) 6480464 Estradiol results in decreased expression of GMFB mRNA CTD PMID:39298647 Gmfb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO GMFB (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of GMFB mRNA CTD PMID:21632981 Gmfb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GMFB mRNA CTD PMID:33387578 Gmfb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Gmfb (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of GMFB mRNA CTD PMID:15034205 and PMID:17942748 Gmfb Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Gmfb (Mus musculus) 6480464 AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of GMFB mRNA] CTD PMID:15034205 Gmfb Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of GMFB mRNA CTD PMID:21346803 Gmfb Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of GMFB mRNA CTD PMID:21346803 Gmfb Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GMFB mRNA CTD PMID:30047161 Gmfb Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of GMFB mRNA CTD PMID:31881176 Gmfb Rat aflatoxin M1 decreases expression ISO GMFB (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of GMFB mRNA CTD PMID:30928695 Gmfb Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of GMFB mRNA CTD PMID:35163327 Gmfb Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of GMFB mRNA CTD PMID:30047161 Gmfb Rat atrazine decreases expression ISO GMFB (Homo sapiens) 6480464 Atrazine results in decreased expression of GMFB mRNA CTD PMID:22378314 Gmfb Rat benzo[a]pyrene multiple interactions ISO Gmfb (Mus musculus) 6480464 AHR protein promotes the reaction [Benzo(a)pyrene results in decreased expression of GMFB mRNA] CTD PMID:15034205 Gmfb Rat benzo[a]pyrene increases expression ISO GMFB (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of GMFB mRNA CTD PMID:26238291 Gmfb Rat benzo[a]pyrene decreases expression ISO Gmfb (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GMFB mRNA CTD PMID:15034205 Gmfb Rat beta-lapachone increases expression ISO GMFB (Homo sapiens) 6480464 beta-lapachone results in increased expression of GMFB mRNA CTD PMID:38218311 Gmfb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GMFB mRNA CTD PMID:25181051 and PMID:34947998 Gmfb Rat bisphenol A decreases expression ISO Gmfb (Mus musculus) 6480464 bisphenol A results in decreased expression of GMFB mRNA CTD PMID:37894381 Gmfb Rat bisphenol A decreases expression ISO GMFB (Homo sapiens) 6480464 bisphenol A results in decreased expression of GMFB protein CTD PMID:34186270 Gmfb Rat bisphenol A decreases methylation ISO GMFB (Homo sapiens) 6480464 bisphenol A results in decreased methylation of GMFB gene CTD PMID:31601247 Gmfb Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GMFB mRNA CTD PMID:29097150 and PMID:33296240 Gmfb Rat bisphenol AF increases expression ISO GMFB (Homo sapiens) 6480464 bisphenol AF results in increased expression of GMFB protein CTD PMID:34186270 Gmfb Rat bisphenol F increases expression ISO GMFB (Homo sapiens) 6480464 bisphenol F results in increased expression of GMFB protein CTD PMID:34186270 Gmfb Rat butan-1-ol multiple interactions ISO GMFB (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of GMFB mRNA CTD PMID:29432896 Gmfb Rat cadmium atom multiple interactions ISO GMFB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GMFB mRNA CTD PMID:35301059 Gmfb Rat cadmium dichloride affects expression EXP 6480464 Cadmium Chloride affects the expression of GMFB mRNA CTD PMID:22110744 Gmfb Rat cadmium dichloride multiple interactions ISO GMFB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GMFB mRNA CTD PMID:35301059 Gmfb Rat cadmium dichloride multiple interactions ISO Gmfb (Mus musculus) 6480464 MT3 affects the reaction [Cadmium Chloride affects the expression of GMFB mRNA] CTD PMID:20371981 Gmfb Rat caffeine multiple interactions ISO Gmfb (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Gmfb Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of GMFB mRNA CTD PMID:17452286 Gmfb Rat chlorpyrifos decreases expression ISO Gmfb (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of GMFB mRNA CTD PMID:37019170 Gmfb Rat cisplatin decreases expression ISO GMFB (Homo sapiens) 6480464 Cisplatin results in decreased expression of GMFB mRNA CTD PMID:27392435 Gmfb Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of GMFB mRNA CTD PMID:24386269 Gmfb Rat copper(II) sulfate increases expression ISO GMFB (Homo sapiens) 6480464 Copper Sulfate results in increased expression of GMFB mRNA CTD PMID:19549813 Gmfb Rat cyclosporin A increases expression ISO GMFB (Homo sapiens) 6480464 Cyclosporine results in increased expression of GMFB mRNA CTD PMID:25562108 Gmfb Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of GMFB mRNA CTD PMID:17452286 Gmfb Rat Dibutyl phosphate affects expression ISO GMFB (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GMFB mRNA CTD PMID:37042841 Gmfb Rat dibutyl phthalate increases expression ISO Gmfb (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of GMFB mRNA CTD PMID:21266533 Gmfb Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of GMFB mRNA CTD PMID:18636392 Gmfb Rat dicrotophos decreases expression ISO GMFB (Homo sapiens) 6480464 dicrotophos results in decreased expression of GMFB mRNA CTD PMID:28302478 Gmfb Rat doxorubicin decreases expression ISO GMFB (Homo sapiens) 6480464 Doxorubicin results in decreased expression of GMFB mRNA CTD PMID:29803840 Gmfb Rat ethanol affects expression ISO Gmfb (Mus musculus) 6480464 Ethanol affects the expression of GMFB mRNA CTD PMID:30319688 Gmfb Rat ethanol multiple interactions ISO Gmfb (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of GMFB mRNA CTD PMID:30319688 Gmfb Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of GMFB protein CTD PMID:33656234 Gmfb Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of GMFB mRNA CTD PMID:24136188 Gmfb Rat folic acid multiple interactions ISO Gmfb (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of GMFB mRNA] CTD PMID:22206623 Gmfb Rat furan increases expression EXP 6480464 furan results in increased expression of GMFB mRNA CTD PMID:25539665 Gmfb Rat hydrogen peroxide multiple interactions ISO Gmfb (Mus musculus) 6480464 [GMFB protein co-treated with AGT protein] results in increased abundance of Hydrogen Peroxide more ... CTD PMID:12791701 Gmfb Rat hydrogen peroxide increases response to substance ISO Gmfb (Mus musculus) 6480464 GMFB protein results in increased susceptibility to Hydrogen Peroxide CTD PMID:12791701 Gmfb Rat hypochlorous acid increases expression ISO Gmfb (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of GMFB mRNA CTD PMID:19376150 Gmfb Rat ivermectin decreases expression ISO GMFB (Homo sapiens) 6480464 Ivermectin results in decreased expression of GMFB protein CTD PMID:32959892 Gmfb Rat lead(0) affects splicing ISO GMFB (Homo sapiens) 6480464 Lead affects the splicing of GMFB mRNA CTD PMID:28903495 Gmfb Rat lipopolysaccharide increases expression ISO Gmfb (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of GMFB mRNA CTD PMID:15919760 Gmfb Rat maneb multiple interactions ISO Gmfb (Mus musculus) 6480464 [Paraquat co-treated with Maneb] results in decreased expression of GMFB mRNA and [Paraquat co-treated with Maneb] results in decreased expression of GMFB protein CTD PMID:17532186 Gmfb Rat methamphetamine affects expression EXP 6480464 Methamphetamine affects the expression of GMFB protein CTD PMID:17904249 Gmfb Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of GMFB mRNA CTD PMID:30467583 Gmfb Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of GMFB mRNA CTD PMID:30047161 Gmfb Rat methylmercury chloride increases expression ISO GMFB (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of GMFB mRNA CTD PMID:28001369 Gmfb Rat monosodium L-glutamate multiple interactions ISO Gmfb (Mus musculus) 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of GMFB mRNA CTD PMID:22078008 Gmfb Rat nickel atom increases expression ISO GMFB (Homo sapiens) 6480464 Nickel results in increased expression of GMFB mRNA CTD PMID:24768652 and PMID:25583101 Gmfb Rat nicotine multiple interactions ISO Gmfb (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Gmfb Rat ozone decreases expression ISO Gmfb (Mus musculus) 6480464 Ozone results in decreased expression of GMFB mRNA CTD PMID:17460151 Gmfb Rat ozone multiple interactions ISO GMFB (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of GMFB mRNA CTD PMID:35430440 Gmfb Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of GMFB mRNA CTD PMID:18636392 Gmfb Rat paracetamol affects expression ISO Gmfb (Mus musculus) 6480464 Acetaminophen affects the expression of GMFB mRNA CTD PMID:17562736 Gmfb Rat paracetamol decreases expression ISO GMFB (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GMFB mRNA CTD PMID:21420995 Gmfb Rat paraquat multiple interactions ISO Gmfb (Mus musculus) 6480464 [Paraquat co-treated with Maneb] results in decreased expression of GMFB mRNA and [Paraquat co-treated with Maneb] results in decreased expression of GMFB protein CTD PMID:17532186 Gmfb Rat perfluorododecanoic acid decreases expression EXP 6480464 perfluorododecanoic acid results in decreased expression of GMFB protein CTD PMID:26168851 Gmfb Rat perfluorooctane-1-sulfonic acid decreases expression ISO GMFB (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of GMFB mRNA CTD PMID:27153767 Gmfb Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Gmfb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GMFB mRNA CTD PMID:36331819 Gmfb Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of GMFB mRNA CTD PMID:19162173 Gmfb Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of GMFB mRNA CTD PMID:35163327 Gmfb Rat phenobarbital decreases expression ISO Gmfb (Mus musculus) 6480464 Phenobarbital results in decreased expression of GMFB mRNA CTD PMID:23091169 Gmfb Rat pirinixic acid increases expression ISO Gmfb (Mus musculus) 6480464 pirinixic acid results in increased expression of GMFB mRNA CTD PMID:17426115 more ... Gmfb Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of GMFB mRNA CTD PMID:26923065 Gmfb Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of GMFB mRNA CTD PMID:19162173 Gmfb Rat resveratrol multiple interactions ISO GMFB (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of GMFB mRNA CTD PMID:23557933 Gmfb Rat rimonabant multiple interactions ISO Gmfb (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of GMFB mRNA] CTD PMID:19030233 Gmfb Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases response to substance ISO Gmfb (Mus musculus) 6480464 GMFB protein results in increased susceptibility to Buthionine Sulfoximine CTD PMID:12791701 Gmfb Rat SB 203580 multiple interactions ISO Gmfb (Mus musculus) 6480464 SB 203580 inhibits the reaction [[GMFB protein co-treated with Hydrogen Peroxide] results in increased abundance of Hydrogen Peroxide] and SB 203580 inhibits the reaction [[GMFB protein co-treated with Hydrogen Peroxide] results in increased activity of CASP3 protein] CTD PMID:12791701 Gmfb Rat sevoflurane affects expression EXP 6480464 sevoflurane affects the expression of GMFB mRNA CTD PMID:15967596 Gmfb Rat sodium arsenate increases expression ISO Gmfb (Mus musculus) 6480464 sodium arsenate results in increased expression of GMFB mRNA CTD PMID:21795629 Gmfb Rat sodium arsenite decreases expression ISO GMFB (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GMFB mRNA CTD PMID:38568856 Gmfb Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of GMFB mRNA CTD PMID:25993096 Gmfb Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of GMFB mRNA CTD PMID:30047161 Gmfb Rat sunitinib increases expression ISO GMFB (Homo sapiens) 6480464 Sunitinib results in increased expression of GMFB mRNA CTD PMID:31533062 Gmfb Rat temozolomide decreases expression ISO GMFB (Homo sapiens) 6480464 Temozolomide results in decreased expression of GMFB mRNA CTD PMID:31758290 Gmfb Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of GMFB mRNA CTD PMID:23411599 and PMID:34492290 Gmfb Rat titanium dioxide decreases methylation ISO Gmfb (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GMFB gene and titanium dioxide results in decreased methylation of GMFB promoter alternative form CTD PMID:35295148 Gmfb Rat trichloroethene affects expression ISO Gmfb (Mus musculus) 6480464 Trichloroethylene affects the expression of GMFB mRNA CTD PMID:21135412 Gmfb Rat trovafloxacin increases expression ISO Gmfb (Mus musculus) 6480464 trovafloxacin results in increased expression of GMFB mRNA CTD PMID:35537566 Gmfb Rat valproic acid affects expression ISO GMFB (Homo sapiens) 6480464 Valproic Acid affects the expression of GMFB mRNA CTD PMID:25979313 Gmfb Rat vincristine increases expression ISO GMFB (Homo sapiens) 6480464 Vincristine results in increased expression of GMFB mRNA CTD PMID:23649840 Gmfb Rat vorinostat decreases expression ISO GMFB (Homo sapiens) 6480464 vorinostat results in decreased expression of GMFB protein CTD PMID:20543569 Gmfb Rat zinc atom multiple interactions ISO GMFB (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of GMFB mRNA CTD PMID:18593933 Gmfb Rat zinc(0) multiple interactions ISO GMFB (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of GMFB mRNA CTD PMID:18593933
(-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin M1 (ISO) alpha-Zearalanol (EXP) amitrole (EXP) atrazine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) chlorpyrifos (EXP,ISO) cisplatin (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) diazinon (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dichlorine (EXP) dicrotophos (ISO) doxorubicin (ISO) ethanol (ISO) fenvalerate (EXP) flutamide (EXP) folic acid (ISO) furan (EXP) hydrogen peroxide (ISO) hypochlorous acid (ISO) ivermectin (ISO) lead(0) (ISO) lipopolysaccharide (ISO) maneb (ISO) methamphetamine (EXP) methapyrilene (EXP) methimazole (EXP) methylmercury chloride (ISO) monosodium L-glutamate (ISO) nickel atom (ISO) nicotine (ISO) ozone (EXP,ISO) paracetamol (ISO) paraquat (ISO) perfluorododecanoic acid (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) pirinixic acid (ISO) poly(I:C) (EXP) pregnenolone 16alpha-carbonitrile (EXP) resveratrol (ISO) rimonabant (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) SB 203580 (ISO) sevoflurane (EXP) sodium arsenate (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sulfadimethoxine (EXP) sunitinib (ISO) temozolomide (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (ISO) trovafloxacin (ISO) valproic acid (ISO) vincristine (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Gmfb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 22,549,705 - 22,560,125 (-) NCBI GRCr8 mRatBN7.2 15 20,069,923 - 20,081,005 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 20,067,263 - 20,080,331 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 22,850,667 - 22,860,918 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 23,808,661 - 23,818,912 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 22,058,939 - 22,069,311 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 23,597,846 - 23,611,541 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 23,601,368 - 23,606,634 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 27,541,333 - 27,555,033 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 22,664,728 - 22,675,100 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 22,680,429 - 22,690,800 (-) NCBI Celera 15 20,468,408 - 20,478,698 (-) NCBI Celera Cytogenetic Map 15 p14 NCBI
GMFB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 54,474,485 - 54,488,980 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 54,474,484 - 54,489,025 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 54,941,203 - 54,955,698 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 54,010,959 - 54,025,494 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 54,010,958 - 54,025,494 NCBI Celera 14 34,990,739 - 35,005,274 (-) NCBI Celera Cytogenetic Map 14 q22.2 NCBI HuRef 14 35,103,853 - 35,118,388 (-) NCBI HuRef CHM1_1 14 54,879,910 - 54,894,446 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 48,679,656 - 48,694,147 (-) NCBI T2T-CHM13v2.0
Gmfb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 47,045,606 - 47,059,711 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 47,045,606 - 47,059,699 (-) Ensembl GRCm39 Ensembl GRCm38 14 46,808,149 - 46,822,259 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 46,808,149 - 46,822,242 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 47,427,824 - 47,441,917 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 45,730,026 - 45,744,086 (-) NCBI MGSCv36 mm8 Celera 14 42,976,366 - 42,990,224 (-) NCBI Celera Cytogenetic Map 14 C1 NCBI cM Map 14 24.32 NCBI
Gmfb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 8,969,398 - 8,984,257 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 8,969,398 - 8,984,008 (+) NCBI ChiLan1.0 ChiLan1.0
GMFB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 55,596,106 - 55,610,916 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 54,812,615 - 54,827,432 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 35,061,469 - 35,076,234 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 53,339,536 - 53,353,873 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 53,343,142 - 53,348,840 (-) Ensembl panpan1.1 panPan2
GMFB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 30,394,020 - 30,408,408 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 30,359,499 - 30,408,357 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 30,162,606 - 30,177,006 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 30,651,153 - 30,665,519 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 30,651,155 - 30,665,487 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 30,255,325 - 30,269,686 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 30,331,779 - 30,346,147 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 30,697,308 - 30,711,696 (-) NCBI UU_Cfam_GSD_1.0
Gmfb
GMFB
GMFB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 31,643,202 - 31,655,819 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 31,640,022 - 31,655,768 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 19,872,348 - 19,887,054 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gmfb
.
Predicted Target Of
Count of predictions: 803 Count of miRNA genes: 322 Interacting mature miRNAs: 428 Transcripts: ENSRNOT00000075602 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1641913 Colcr2 Colorectal carcinoma resistance QTL 2 6.57 0.0197 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 15 2266368 22711984 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 2324620 Coatc3 Coat color QTL 3 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 15 19856566 46187442 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 631550 Bw7 Body weight QTL 7 3.6 body mass (VT:0001259) body weight (CMO:0000012) 15 19856566 34924750 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 5685002 Bss103 Bone structure and strength QTL 103 2.8 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 15 14481165 28469888 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat
RH132322
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 20,067,440 - 20,067,634 (+) MAPPER mRatBN7.2 Rnor_6.0 15 23,598,031 - 23,598,224 NCBI Rnor6.0 Rnor_5.0 15 27,541,518 - 27,541,711 UniSTS Rnor5.0 RGSC_v3.4 15 22,662,241 - 22,662,434 UniSTS RGSC3.4 Celera 15 20,465,921 - 20,466,114 UniSTS RH 3.4 Map 15 186.3 UniSTS Cytogenetic Map 15 p14 UniSTS
BE095473
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 20,080,436 - 20,080,602 (+) MAPPER mRatBN7.2 Rnor_6.0 15 23,611,027 - 23,611,192 NCBI Rnor6.0 Rnor_5.0 15 27,554,514 - 27,554,679 UniSTS Rnor5.0 RGSC_v3.4 15 22,675,237 - 22,675,402 UniSTS RGSC3.4 Celera 15 20,478,835 - 20,479,000 UniSTS RH 3.4 Map 15 189.0 UniSTS Cytogenetic Map 15 p14 UniSTS
Gmfb
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 20,069,957 - 20,070,671 (+) MAPPER mRatBN7.2 Rnor_6.0 15 23,600,548 - 23,601,261 NCBI Rnor6.0 Rnor_5.0 15 27,544,035 - 27,544,748 UniSTS Rnor5.0 Celera 15 20,468,438 - 20,469,151 UniSTS Cytogenetic Map 15 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000075602 ⟹ ENSRNOP00000067695
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 20,070,778 - 20,076,045 (-) Ensembl Rnor_6.0 Ensembl 15 23,601,368 - 23,606,634 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101993 ⟹ ENSRNOP00000089942
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 20,067,263 - 20,080,331 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119616 ⟹ ENSRNOP00000083410
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 20,067,263 - 20,076,414 (-) Ensembl
RefSeq Acc Id:
NM_031032 ⟹ NP_112294
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,549,705 - 22,560,077 (-) NCBI mRatBN7.2 15 20,069,928 - 20,080,300 (-) NCBI Rnor_6.0 15 23,600,518 - 23,610,890 (-) NCBI Rnor_5.0 15 27,541,333 - 27,555,033 (-) NCBI RGSC_v3.4 15 22,664,728 - 22,675,100 (-) RGD Celera 15 20,468,408 - 20,478,698 (-) RGD
Sequence:
CAGGAAGGGAGGTGGCTGCAGAGCCATTCTTAAAGGGGCCCAAGAGATCATACGGCAACGGACGGCTGACGACCGGAAGGAAAATGAGTGAGTCTTTGGTGGTTTGTGATGTTGCTGAAGATTTAGTG
hide sequence
RefSeq Acc Id:
XM_063274691 ⟹ XP_063130761
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,552,377 - 22,560,125 (-) NCBI
RefSeq Acc Id:
XM_063274692 ⟹ XP_063130762
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,552,377 - 22,558,041 (-) NCBI
RefSeq Acc Id:
NP_112294 ⟸ NM_031032
- UniProtKB:
Q63228 (UniProtKB/Swiss-Prot), A6KE25 (UniProtKB/TrEMBL), M0RDJ4 (UniProtKB/TrEMBL)
- Sequence:
MSESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTED
hide sequence
Ensembl Acc Id:
ENSRNOP00000067695 ⟸ ENSRNOT00000075602
Ensembl Acc Id:
ENSRNOP00000089942 ⟸ ENSRNOT00000101993
Ensembl Acc Id:
ENSRNOP00000083410 ⟸ ENSRNOT00000119616
RefSeq Acc Id:
XP_063130761 ⟸ XM_063274691
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063130762 ⟸ XM_063274692
- Peptide Label:
isoform X2
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-07-09
Gmfb
glia maturation factor, beta
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_expression
mRNA expressed in brain and spinal chord
70747
gene_expression
mRNA detected in brain from E10 to postnatal month 14
70747
gene_expression
protein level increases slowly through embryonic period to plateau at P7
70747
gene_homology
deduced amino acid sequence differed from human homolog in only 3 places; His27 (in place of Asn), Val51 (for Ile), and Leu93 (for Val)
70747
