Symbol:
Fut11
Name:
fucosyltransferase 11
RGD ID:
628731
Description:
Predicted to enable alpha-(1->3)-fucosyltransferase activity. Predicted to be involved in N-glycan fucosylation. Predicted to be located in Golgi cisterna membrane and Golgi membrane. Human ortholog(s) of this gene implicated in stomach cancer. Orthologous to human FUT11 (fucosyltransferase 11); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
alpha-(1,3)-fucosyltransferase 11; alpha3-fucosyltransferase 11; fuc-TXI; fucosyltransferase 11 (alpha (1,3) fucosyltransferase); fucosyltransferase XI; fucT-XI; galactoside 3-L-fucosyltransferase 11; MGC94472
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FUT11 (fucosyltransferase 11) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Fut11 (fucosyltransferase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fut11 (fucosyltransferase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FUT11 (fucosyltransferase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FUT11 (fucosyltransferase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fut11 (fucosyltransferase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FUT11 (fucosyltransferase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FUT11 (fucosyltransferase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fut11 (fucosyltransferase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
FUT11 (fucosyltransferase 11)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fut11 (fucosyltransferase 11)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fut11 (fucosyltransferase 11 (alpha (1,3) fucosyltransferase))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
FucTB
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fut11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 3,648,022 - 3,651,582 (-) NCBI GRCr8 mRatBN7.2 15 3,598,768 - 3,602,328 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 3,598,758 - 3,602,356 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 3,608,959 - 3,612,519 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 4,995,435 - 4,998,995 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 3,607,768 - 3,611,328 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 4,031,504 - 4,035,064 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 4,031,504 - 4,035,064 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 8,132,722 - 8,136,282 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 3,824,218 - 3,827,778 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 3,824,207 - 3,827,806 (-) NCBI Celera 15 991,857 - 995,417 (+) NCBI Celera Cytogenetic Map 15 p16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Fut11 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 3,648,022 - 3,651,582 (-) NCBI GRCr8 mRatBN7.2 15 3,598,768 - 3,602,328 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 3,598,758 - 3,602,356 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 3,608,959 - 3,612,519 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 4,995,435 - 4,998,995 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 3,607,768 - 3,611,328 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 4,031,504 - 4,035,064 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 4,031,504 - 4,035,064 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 8,132,722 - 8,136,282 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 3,824,218 - 3,827,778 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 3,824,207 - 3,827,806 (-) NCBI Celera 15 991,857 - 995,417 (+) NCBI Celera Cytogenetic Map 15 p16 NCBI
FUT11 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 73,772,276 - 73,780,254 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 73,772,276 - 73,780,251 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 75,532,034 - 75,535,977 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 75,202,055 - 75,205,983 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 75,202,054 - 75,205,980 NCBI Celera 10 68,815,227 - 68,819,145 (+) NCBI Celera Cytogenetic Map 10 q22.2 NCBI HuRef 10 69,527,224 - 69,531,120 (+) NCBI HuRef CHM1_1 10 75,813,820 - 75,817,752 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 74,643,692 - 74,651,652 (+) NCBI T2T-CHM13v2.0
Fut11 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 20,745,036 - 20,750,265 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 20,745,036 - 20,751,084 (+) Ensembl GRCm39 Ensembl GRCm38 14 20,694,968 - 20,700,197 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 20,694,968 - 20,701,016 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 21,514,190 - 21,519,419 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 19,483,520 - 19,488,749 (+) NCBI MGSCv36 mm8 Celera 14 17,077,738 - 17,082,963 (+) NCBI Celera Cytogenetic Map 14 A3 NCBI cM Map 14 11.53 NCBI
Fut11 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 18,126,167 - 18,132,805 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 18,126,165 - 18,132,874 (-) NCBI ChiLan1.0 ChiLan1.0
FUT11 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 85,923,086 - 85,931,133 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 85,928,410 - 85,936,457 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 70,295,122 - 70,301,897 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 72,967,970 - 72,974,517 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 72,968,025 - 72,972,030 (+) Ensembl panpan1.1 panPan2
FUT11 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 24,209,235 - 24,213,192 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 24,209,271 - 24,212,515 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 24,346,846 - 24,352,467 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 24,489,372 - 24,495,211 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 24,489,388 - 24,492,854 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 24,386,557 - 24,392,344 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 24,587,177 - 24,592,794 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 24,942,244 - 24,947,858 (+) NCBI UU_Cfam_GSD_1.0
Fut11 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 56,874,870 - 56,881,772 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936521 5,369,174 - 5,374,428 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936521 5,367,614 - 5,374,472 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FUT11 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 76,498,827 - 76,505,767 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 76,497,894 - 76,505,776 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 82,625,856 - 82,629,556 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FUT11 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 57,593,732 - 57,600,704 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 57,597,011 - 57,600,617 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 18,169,493 - 18,177,902 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fut11
.
Predicted Target Of
Count of predictions: 85 Count of miRNA genes: 73 Interacting mature miRNAs: 77 Transcripts: ENSRNOT00000012300 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641913 Colcr2 Colorectal carcinoma resistance QTL 2 6.57 0.0197 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 15 2266368 22711984 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 5684946 Bss98 Bone structure and strength QTL 98 3.9 0.0026 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 15 1058250 14481294 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat
RH128878
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 3,602,527 - 3,602,710 (+) MAPPER mRatBN7.2 Rnor_6.0 15 4,035,264 - 4,035,446 NCBI Rnor6.0 Rnor_5.0 15 8,136,482 - 8,136,664 UniSTS Rnor5.0 RGSC_v3.4 15 3,827,978 - 3,828,160 UniSTS RGSC3.4 Celera 15 991,475 - 991,657 UniSTS RH 3.4 Map 15 65.8 UniSTS Cytogenetic Map 15 p16 UniSTS
RH139808
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 3,600,960 - 3,601,149 (+) MAPPER mRatBN7.2 Rnor_6.0 15 4,033,697 - 4,033,885 NCBI Rnor6.0 Rnor_5.0 15 8,134,915 - 8,135,103 UniSTS Rnor5.0 RGSC_v3.4 15 3,826,411 - 3,826,599 UniSTS RGSC3.4 Celera 15 993,036 - 993,224 UniSTS RH 3.4 Map 15 66.2 UniSTS Cytogenetic Map 15 p16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012300 ⟹ ENSRNOP00000012300
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 3,598,758 - 3,602,356 (-) Ensembl Rnor_6.0 Ensembl 15 4,031,504 - 4,035,064 (-) Ensembl
RefSeq Acc Id:
NM_173308 ⟹ NP_775430
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 3,648,022 - 3,651,582 (-) NCBI mRatBN7.2 15 3,598,768 - 3,602,328 (-) NCBI Rnor_6.0 15 4,031,504 - 4,035,064 (-) NCBI Rnor_5.0 15 8,132,722 - 8,136,282 (-) NCBI RGSC_v3.4 15 3,824,218 - 3,827,778 (-) RGD Celera 15 991,857 - 995,417 (+) RGD
Sequence:
GTGGGTCCAGTGTGGACATGGCCGCTCGCTACACCGAGGCGGTGTTGGCCGCCCTGGGGGTGCTCAGTGTCTGTTCGGCCAGCAGCAGCTCCGGGTCTGGGGCATCGGGGAAGGCGGGTGGGGAGGCT
hide sequence
RefSeq Acc Id:
NP_775430 ⟸ NM_173308
- Peptide Label:
precursor
- UniProtKB:
Q8CG40 (UniProtKB/Swiss-Prot), Q68FV3 (UniProtKB/Swiss-Prot), A6KKP8 (UniProtKB/TrEMBL)
- Sequence:
MAARYTEAVLAALGVLSVCSASSSSGSGASGKAGGEAEWAEPWDGAVFRPPAALGAVGMTRGLGSPPPGNAETVDLPVLLWWSPGLFPHFPGDSERIECALGACVASRDRRARADPRTRALLFYGTDF
hide sequence
Ensembl Acc Id:
ENSRNOP00000012300 ⟸ ENSRNOT00000012300
RGD ID: 13699561 Promoter ID: EPDNEW_R10084 Type: multiple initiation site Name: Fut11_1 Description: fucosyltransferase 11 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 4,035,076 - 4,035,136 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-13
Fut11
fucosyltransferase 11
Fut11
fucosyltransferase 11 (alpha (1,3) fucosyltransferase)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-19
Fut11
fucosyltransferase 11 (alpha (1,3) fucosyltransferase)
Fut11
fucosyltransferase 11
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Fut11
fucosyltransferase 11
alpha3-fucosyltransferase 11
Name updated
1299863 APPROVED
2003-02-27
Fut11
alpha3-fucosyltransferase 11
Symbol and Name status set to provisional
70820 PROVISIONAL
