Symbol:
Elovl5
Name:
ELOVL fatty acid elongase 5
RGD ID:
620583
Description:
Enables fatty acid elongase activity. Involved in fatty acid elongation, polyunsaturated fatty acid and very long-chain fatty acid biosynthetic process. Predicted to be located in dendritic tree; endoplasmic reticulum; and neuronal cell body. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in spinocerebellar ataxia type 38. Orthologous to human ELOVL5 (ELOVL fatty acid elongase 5); PARTICIPATES IN alpha-linolenic acid metabolic pathway; linoleic acid metabolic pathway; unsaturated fatty acid biosynthetic pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
3-keto acyl-CoA synthase Elovl5; elongation of long chain fatty acids family member 5; elongation of very long chain fatty acids protein 5; elongation of very long chain fatty acids-like 5; ELOVL FA elongase 5; ELOVL family member 5, elongation of long chain fatty acids; ELOVL family member 5, elongation of long chain fatty acids (yeast); fatty acid elongase 1; rELO1; very long chain 3-ketoacyl-CoA synthase 5; very long chain 3-oxoacyl-CoA synthase 5; very long chain fatty acid elongase 5; very-long-chain 3-oxoacyl-CoA synthase 5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 87,671,164 - 87,737,618 (+) NCBI GRCr8 mRatBN7.2 8 78,790,846 - 78,857,307 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 78,790,846 - 78,857,284 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 84,316,763 - 84,342,848 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 82,593,410 - 82,619,495 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 80,416,122 - 80,442,207 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 85,220,941 - 85,287,449 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 85,259,982 - 85,285,983 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 84,786,562 - 84,853,064 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 82,922,551 - 82,948,348 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 82,941,604 - 82,967,402 (+) NCBI Celera 8 78,575,885 - 78,600,766 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Elovl5 Rat (1->4)-beta-D-glucan multiple interactions ISO Elovl5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ELOVL5 mRNA CTD PMID:36331819 Elovl5 Rat 1,2-dimethylhydrazine multiple interactions ISO Elovl5 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ELOVL5 mRNA CTD PMID:22206623 Elovl5 Rat 1,2-dimethylhydrazine decreases expression ISO Elovl5 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ELOVL5 mRNA CTD PMID:22206623 Elovl5 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of ELOVL5 mRNA CTD PMID:25380136 Elovl5 Rat 17alpha-ethynylestradiol multiple interactions ISO Elovl5 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ELOVL5 mRNA CTD PMID:17942748 Elovl5 Rat 17beta-estradiol increases expression ISO ELOVL5 (Homo sapiens) 6480464 Estradiol results in increased expression of ELOVL5 mRNA CTD PMID:16514628 Elovl5 Rat 17beta-estradiol increases expression ISO Elovl5 (Mus musculus) 6480464 Estradiol results in increased expression of ELOVL5 mRNA CTD PMID:39298647 Elovl5 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ELOVL5 mRNA CTD PMID:32145629 Elovl5 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of ELOVL5 mRNA CTD PMID:26496021 Elovl5 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO ELOVL5 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of ELOVL5 mRNA CTD PMID:29581250 Elovl5 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Elovl5 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ELOVL5 mRNA CTD PMID:17942748 Elovl5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Elovl5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ELOVL5 mRNA CTD PMID:28238261 Elovl5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Elovl5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ELOVL5 mRNA CTD PMID:20702594 more ... Elovl5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ELOVL5 mRNA CTD PMID:16960034 more ... Elovl5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Elovl5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ELOVL5 mRNA CTD PMID:16611356 more ... Elovl5 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Elovl5 (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Elovl5 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ELOVL5 mRNA CTD PMID:21346803 Elovl5 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ELOVL5 mRNA CTD PMID:21346803 Elovl5 Rat 2-bromohexadecanoic acid multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of ELOVL5 protein] CTD PMID:38195004 Elovl5 Rat 2-hydroxypropanoic acid increases expression ISO ELOVL5 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ELOVL5 mRNA CTD PMID:30851411 Elovl5 Rat 3,3',4,4',5-pentachlorobiphenyl affects expression ISO Elovl5 (Mus musculus) 6480464 3 more ... CTD PMID:20702594 Elovl5 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of ELOVL5 mRNA CTD PMID:28628672 Elovl5 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of ELOVL5 mRNA CTD PMID:25380136 Elovl5 Rat 4,4'-sulfonyldiphenol affects expression ISO Elovl5 (Mus musculus) 6480464 bisphenol S affects the expression of ELOVL5 mRNA CTD PMID:39298647 Elovl5 Rat 4,4'-sulfonyldiphenol increases expression ISO ELOVL5 (Homo sapiens) 6480464 bisphenol S results in increased expression of ELOVL5 protein CTD PMID:34186270 Elovl5 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Elovl5 (Mus musculus) 6480464 bisphenol S results in decreased methylation of ELOVL5 exon CTD PMID:33297965 Elovl5 Rat 5-fluorouracil affects response to substance ISO ELOVL5 (Homo sapiens) 6480464 ELOVL5 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Elovl5 Rat acetylsalicylic acid increases expression ISO ELOVL5 (Homo sapiens) 6480464 Aspirin results in increased expression of ELOVL5 mRNA CTD PMID:15928584 Elovl5 Rat acetylsalicylic acid decreases expression ISO ELOVL5 (Homo sapiens) 6480464 Aspirin results in decreased expression of ELOVL5 mRNA CTD PMID:11906190 Elovl5 Rat acrylamide increases expression ISO ELOVL5 (Homo sapiens) 6480464 Acrylamide results in increased expression of ELOVL5 mRNA CTD PMID:32763439 Elovl5 Rat afimoxifene decreases expression ISO ELOVL5 (Homo sapiens) 6480464 afimoxifene results in decreased expression of ELOVL5 mRNA CTD PMID:16514628 Elovl5 Rat aflatoxin B1 decreases expression ISO Elovl5 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of ELOVL5 mRNA CTD PMID:19770486 Elovl5 Rat aflatoxin B1 decreases methylation ISO ELOVL5 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ELOVL5 gene CTD PMID:27153756 Elovl5 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ELOVL5 mRNA CTD PMID:16483693 Elovl5 Rat aristolochic acid A decreases expression ISO ELOVL5 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ELOVL5 mRNA CTD PMID:33212167 Elovl5 Rat arsenous acid decreases expression ISO ELOVL5 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ELOVL5 mRNA CTD PMID:19128835 Elovl5 Rat benzene increases expression EXP 6480464 Benzene results in increased expression of ELOVL5 mRNA CTD PMID:15878777 Elovl5 Rat benzo[a]pyrene decreases expression ISO ELOVL5 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ELOVL5 mRNA CTD PMID:20064835 Elovl5 Rat benzo[a]pyrene affects methylation ISO ELOVL5 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ELOVL5 5' UTR CTD PMID:27901495 Elovl5 Rat benzo[a]pyrene decreases methylation ISO ELOVL5 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ELOVL5 promoter CTD PMID:27901495 Elovl5 Rat benzo[a]pyrene decreases expression ISO Elovl5 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ELOVL5 mRNA CTD PMID:22228805 Elovl5 Rat benzo[a]pyrene increases expression ISO ELOVL5 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ELOVL5 mRNA CTD PMID:20498004 Elovl5 Rat benzo[a]pyrene diol epoxide I decreases expression ISO ELOVL5 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Elovl5 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Elovl5 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of ELOVL5 mRNA] CTD PMID:19850644 Elovl5 Rat bis(2-ethylhexyl) phthalate increases expression ISO Elovl5 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ELOVL5 mRNA CTD PMID:19245819 and PMID:19850644 Elovl5 Rat bisphenol A increases expression ISO Elovl5 (Mus musculus) 6480464 bisphenol A results in increased expression of ELOVL5 mRNA CTD PMID:21932408 Elovl5 Rat bisphenol A increases expression ISO ELOVL5 (Homo sapiens) 6480464 bisphenol A results in increased expression of ELOVL5 protein CTD PMID:34186270 Elovl5 Rat bisphenol A multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ELOVL5 gene CTD PMID:31601247 Elovl5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ELOVL5 mRNA CTD PMID:32145629 Elovl5 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ELOVL5 mRNA CTD PMID:30903817 Elovl5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ELOVL5 mRNA CTD PMID:25181051 and PMID:34947998 Elovl5 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of ELOVL5 mRNA CTD PMID:26496021 Elovl5 Rat bisphenol AF increases expression ISO ELOVL5 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ELOVL5 protein CTD PMID:34186270 Elovl5 Rat bisphenol F increases expression ISO ELOVL5 (Homo sapiens) 6480464 bisphenol F results in increased expression of ELOVL5 protein CTD PMID:34186270 Elovl5 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of ELOVL5 mRNA CTD PMID:24136188 Elovl5 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of ELOVL5 mRNA CTD PMID:19167457 Elovl5 Rat cadmium atom multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of ELOVL5 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of ELOVL5 protein CTD PMID:38195004 Elovl5 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ELOVL5 mRNA CTD PMID:25993096 Elovl5 Rat cadmium dichloride multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of ELOVL5 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of ELOVL5 protein CTD PMID:38195004 Elovl5 Rat captan decreases expression ISO Elovl5 (Mus musculus) 6480464 Captan results in decreased expression of ELOVL5 mRNA CTD PMID:31558096 Elovl5 Rat carbon nanotube decreases expression ISO Elovl5 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Elovl5 Rat CGP 52608 multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ELOVL5 gene] CTD PMID:28238834 Elovl5 Rat chlormequat chloride increases expression EXP 6480464 Chlormequat results in increased expression of ELOVL5 protein CTD PMID:34958886 Elovl5 Rat clobetasol increases expression ISO Elovl5 (Mus musculus) 6480464 Clobetasol results in increased expression of ELOVL5 mRNA CTD PMID:27462272 Elovl5 Rat cobalt dichloride decreases expression ISO ELOVL5 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ELOVL5 mRNA CTD PMID:19320972 Elovl5 Rat copper(II) sulfate increases expression ISO ELOVL5 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ELOVL5 mRNA CTD PMID:19549813 Elovl5 Rat coumestrol increases expression ISO ELOVL5 (Homo sapiens) 6480464 Coumestrol results in increased expression of ELOVL5 mRNA CTD PMID:19167446 Elovl5 Rat coumestrol multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of ELOVL5 mRNA CTD PMID:19167446 Elovl5 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of ELOVL5 mRNA CTD PMID:26577399 Elovl5 Rat cyclosporin A increases expression ISO ELOVL5 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ELOVL5 mRNA CTD PMID:20106945 Elovl5 Rat dexamethasone increases expression ISO ELOVL5 (Homo sapiens) 6480464 Dexamethasone results in increased expression of ELOVL5 mRNA CTD PMID:25047013 Elovl5 Rat dexamethasone multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of ELOVL5 mRNA CTD PMID:28628672 Elovl5 Rat Di-n-hexyl phthalate decreases expression ISO ELOVL5 (Homo sapiens) 6480464 di-n-hexyl phthalate results in decreased expression of ELOVL5 mRNA CTD PMID:33043605 Elovl5 Rat diarsenic trioxide decreases expression ISO ELOVL5 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ELOVL5 mRNA CTD PMID:19128835 Elovl5 Rat dibenzofurans increases expression ISO Elovl5 (Mus musculus) 6480464 Dibenzofurans results in increased expression of ELOVL5 mRNA CTD PMID:34254344 Elovl5 Rat Dibutyl phosphate affects expression ISO ELOVL5 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ELOVL5 mRNA CTD PMID:37042841 Elovl5 Rat dichloroacetic acid increases expression ISO Elovl5 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of ELOVL5 mRNA CTD PMID:28962523 Elovl5 Rat dorsomorphin multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ELOVL5 mRNA CTD PMID:27188386 Elovl5 Rat ethanol decreases expression ISO Elovl5 (Mus musculus) 6480464 Ethanol results in decreased expression of ELOVL5 mRNA CTD PMID:19167417 Elovl5 Rat ethanol multiple interactions ISO Elovl5 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of ELOVL5 mRNA CTD PMID:30319688 Elovl5 Rat ethanol increases expression ISO Elovl5 (Mus musculus) 6480464 Ethanol results in increased expression of ELOVL5 mRNA CTD PMID:30319688 Elovl5 Rat fentin chloride decreases expression EXP 6480464 triphenyltin chloride results in decreased expression of ELOVL5 mRNA CTD PMID:37156404 Elovl5 Rat fentin chloride increases expression EXP 6480464 triphenyltin chloride results in increased expression of ELOVL5 mRNA CTD PMID:37156404 Elovl5 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of ELOVL5 mRNA CTD PMID:23962444 Elovl5 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ELOVL5 mRNA CTD PMID:24136188 Elovl5 Rat folic acid multiple interactions ISO Elovl5 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ELOVL5 mRNA CTD PMID:22206623 Elovl5 Rat folpet decreases expression ISO Elovl5 (Mus musculus) 6480464 folpet results in decreased expression of ELOVL5 mRNA CTD PMID:31558096 Elovl5 Rat FR900359 decreases phosphorylation ISO ELOVL5 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of ELOVL5 protein CTD PMID:37730182 Elovl5 Rat fulvestrant decreases expression ISO ELOVL5 (Homo sapiens) 6480464 fulvestrant results in decreased expression of ELOVL5 mRNA CTD PMID:16514628 Elovl5 Rat fulvestrant multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ELOVL5 gene CTD PMID:31601247 Elovl5 Rat genistein decreases expression ISO ELOVL5 (Homo sapiens) 6480464 Genistein results in decreased expression of ELOVL5 mRNA CTD PMID:15378649 Elovl5 Rat GW 4064 multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [GW 4064 co-treated with Oleic Acid] results in decreased expression of ELOVL5 mRNA CTD PMID:30611723 Elovl5 Rat GW 7647 increases expression ISO ELOVL5 (Homo sapiens) 6480464 GW 7647 results in increased expression of ELOVL5 mRNA CTD PMID:30611723 Elovl5 Rat hydroquinone decreases expression ISO ELOVL5 (Homo sapiens) 6480464 hydroquinone results in decreased expression of ELOVL5 mRNA CTD PMID:31256213 Elovl5 Rat indometacin multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of ELOVL5 mRNA CTD PMID:28628672 Elovl5 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of ELOVL5 mRNA CTD PMID:36868495 Elovl5 Rat inulin multiple interactions ISO Elovl5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ELOVL5 mRNA CTD PMID:36331819 Elovl5 Rat isotretinoin decreases expression ISO ELOVL5 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of ELOVL5 mRNA CTD PMID:20436886 Elovl5 Rat ivermectin decreases expression ISO ELOVL5 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ELOVL5 protein CTD PMID:32959892 Elovl5 Rat ketoconazole decreases expression ISO ELOVL5 (Homo sapiens) 6480464 Ketoconazole results in decreased expression of ELOVL5 mRNA CTD PMID:36621641 Elovl5 Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of ELOVL5 mRNA CTD PMID:24136188 Elovl5 Rat levonorgestrel multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of ELOVL5 mRNA CTD PMID:19074003 Elovl5 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ELOVL5 gene CTD PMID:35440735 Elovl5 Rat methylmercury chloride increases expression ISO ELOVL5 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ELOVL5 mRNA CTD PMID:28001369 Elovl5 Rat miconazole increases expression ISO Elovl5 (Mus musculus) 6480464 Miconazole results in increased expression of ELOVL5 mRNA CTD PMID:27462272 Elovl5 Rat mitoxantrone affects response to substance ISO ELOVL5 (Homo sapiens) 6480464 ELOVL5 mRNA affects the susceptibility to Mitoxantrone CTD PMID:16044152 Elovl5 Rat N-methyl-4-phenylpyridinium decreases expression ISO Elovl5 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of ELOVL5 protein CTD PMID:26558463 Elovl5 Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of ELOVL5 mRNA CTD PMID:25380136 Elovl5 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of ELOVL5 mRNA CTD PMID:24136188 Elovl5 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of ELOVL5 mRNA CTD PMID:24136188 Elovl5 Rat oleic acid multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [GW 4064 co-treated with Oleic Acid] results in decreased expression of ELOVL5 mRNA CTD PMID:30611723 Elovl5 Rat ozone multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ELOVL5 mRNA CTD PMID:35430440 Elovl5 Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of ELOVL5 mRNA CTD PMID:27638505 Elovl5 Rat paracetamol increases expression ISO ELOVL5 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ELOVL5 mRNA CTD PMID:21420995 Elovl5 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ELOVL5 mRNA CTD PMID:30723492 Elovl5 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of ELOVL5 mRNA CTD PMID:18692542 Elovl5 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Elovl5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ELOVL5 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ELOVL5 mRNA CTD PMID:36331819 Elovl5 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of ELOVL5 mRNA CTD PMID:18158353 Elovl5 Rat phenylmercury acetate decreases expression ISO ELOVL5 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of ELOVL5 mRNA CTD PMID:26272509 Elovl5 Rat phenylmercury acetate multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ELOVL5 mRNA CTD PMID:27188386 Elovl5 Rat pirinixic acid multiple interactions ISO Elovl5 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in increased expression of ELOVL5 mRNA] CTD PMID:16790840 Elovl5 Rat pirinixic acid increases expression ISO Elovl5 (Mus musculus) 6480464 pirinixic acid results in increased expression of ELOVL5 mRNA CTD PMID:16790840 more ... Elovl5 Rat pirinixic acid increases activity EXP 6480464 pirinixic acid results in increased activity of ELOVL5 protein CTD PMID:15654130 Elovl5 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of ELOVL5 mRNA CTD PMID:15654130 Elovl5 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Elovl5 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of ELOVL5 mRNA CTD PMID:28903501 Elovl5 Rat propiconazole decreases expression ISO Elovl5 (Mus musculus) 6480464 propiconazole results in decreased expression of ELOVL5 mRNA CTD PMID:21278054 Elovl5 Rat rac-lactic acid increases expression ISO ELOVL5 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ELOVL5 mRNA CTD PMID:30851411 Elovl5 Rat raloxifene decreases expression ISO ELOVL5 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of ELOVL5 mRNA CTD PMID:16514628 Elovl5 Rat resveratrol multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of ELOVL5 mRNA CTD PMID:19167446 Elovl5 Rat resveratrol increases expression ISO Elovl5 (Mus musculus) 6480464 resveratrol results in increased expression of ELOVL5 protein CTD PMID:25505154 Elovl5 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ELOVL5 mRNA CTD PMID:28374803 Elovl5 Rat SB 431542 multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ELOVL5 mRNA CTD PMID:27188386 Elovl5 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of ELOVL5 mRNA CTD PMID:25993096 Elovl5 Rat testosterone undecanoate multiple interactions ISO ELOVL5 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of ELOVL5 mRNA CTD PMID:19074003 Elovl5 Rat tetrachloroethene increases expression ISO Elovl5 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of ELOVL5 mRNA CTD PMID:28973375 Elovl5 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ELOVL5 mRNA CTD PMID:31150632 Elovl5 Rat tetrachloromethane decreases expression ISO Elovl5 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ELOVL5 mRNA CTD PMID:31919559 Elovl5 Rat tetracycline increases expression ISO Elovl5 (Mus musculus) 6480464 Tetracycline results in increased expression of ELOVL5 mRNA CTD PMID:16917069 Elovl5 Rat titanium dioxide decreases methylation ISO Elovl5 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ELOVL5 gene and titanium dioxide results in decreased methylation of ELOVL5 promoter CTD PMID:35295148 Elovl5 Rat trichloroethene increases expression ISO Elovl5 (Mus musculus) 6480464 Trichloroethylene results in increased expression of ELOVL5 mRNA CTD PMID:25549359 Elovl5 Rat triphenyl phosphate affects expression ISO ELOVL5 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ELOVL5 mRNA CTD PMID:37042841 Elovl5 Rat Triptolide decreases expression ISO Elovl5 (Mus musculus) 6480464 triptolide results in decreased expression of ELOVL5 mRNA CTD PMID:32835833 Elovl5 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of ELOVL5 mRNA CTD PMID:24136188 Elovl5 Rat valproic acid increases expression ISO Elovl5 (Mus musculus) 6480464 Valproic Acid results in increased expression of ELOVL5 mRNA CTD PMID:21427059 Elovl5 Rat valproic acid affects expression ISO ELOVL5 (Homo sapiens) 6480464 Valproic Acid affects the expression of ELOVL5 mRNA CTD PMID:25979313
Biological Process
Only show annotations with direct experimental evidence (0 objects hidden)
Elovl5 Rat alpha-linolenic acid metabolic process involved_in ISO Elovl5 (Mus musculus) 1624291 MGI:3847980 PMID:18838740 RGD PMID:18838740 Elovl5 Rat alpha-linolenic acid metabolic process involved_in IEA UniProtKB:Q8BHI7 and ensembl:ENSMUSP00000034904 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl5 Rat fatty acid biosynthetic process involved_in IEA UniProtKB-KW:KW-0275 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Elovl5 Rat fatty acid biosynthetic process involved_in IEA UniProtKB:Q8BHI7 and ensembl:ENSMUSP00000034904 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl5 Rat fatty acid biosynthetic process involved_in ISO Elovl5 (Mus musculus) 1624291 MGI:3847980 PMID:18838740 and PMID:35933444 RGD PMID:18838740 and PMID:35933444 Elovl5 Rat fatty acid derivative biosynthetic process involved_in ISO Elovl5 (Mus musculus) 1624291 MGI:3847980 PMID:18838740 RGD PMID:18838740 Elovl5 Rat fatty acid derivative biosynthetic process involved_in IEA UniProtKB:Q8BHI7 and ensembl:ENSMUSP00000034904 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl5 Rat fatty acid elongation, monounsaturated fatty acid involved_in ISS UniProtKB:Q9NYP7 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Elovl5 Rat fatty acid elongation, monounsaturated fatty acid involved_in IEA UniProtKB:Q9NYP7 and ensembl:ENSP000003066401600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl5 Rat fatty acid elongation, monounsaturated fatty acid involved_in IBA MGI:1195976 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Elovl5 Rat fatty acid elongation, monounsaturated fatty acid involved_in ISO ELOVL5 (Homo sapiens) 1624291 PMID:20427700 RGD PMID:20427700 Elovl5 Rat fatty acid elongation, monounsaturated fatty acid involved_in IEA UniRule:UR000254918 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Elovl5 Rat fatty acid elongation, polyunsaturated fatty acid involved_in IEA UniRule:UR000254918 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Elovl5 Rat fatty acid elongation, polyunsaturated fatty acid involved_in IEA UniProtKB:Q9NYP7 and ensembl:ENSP000003066401600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl5 Rat fatty acid elongation, polyunsaturated fatty acid involved_in IBA MGI:1858960 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Elovl5 Rat fatty acid elongation, polyunsaturated fatty acid involved_in ISO ELOVL5 (Homo sapiens) 1624291 PMID:20427700 and PMID:20937905 RGD PMID:20427700 and PMID:20937905 Elovl5 Rat fatty acid elongation, polyunsaturated fatty acid involved_in IDA 8554529 PMID:12005057 UniProt Elovl5 Rat fatty acid elongation, saturated fatty acid involved_in IEA InterPro:IPR033677 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Elovl5 Rat fatty acid elongation, saturated fatty acid involved_in IBA FB:FBgn0260960 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Elovl5 Rat fatty acid metabolic process involved_in IEA UniProtKB-KW:KW-0276 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Elovl5 Rat linoleic acid metabolic process involved_in IEA UniProtKB:Q8BHI7 and ensembl:ENSMUSP00000034904 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl5 Rat linoleic acid metabolic process involved_in ISO Elovl5 (Mus musculus) 1624291 MGI:3847980 PMID:18838740 and PMID:35933444 RGD PMID:18838740 and PMID:35933444 Elovl5 Rat lipid metabolic process involved_in IEA UniProtKB-KW:KW-0443 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Elovl5 Rat long-chain fatty acid biosynthetic process involved_in ISO Elovl5 (Mus musculus) 1624291 MGI:3847980 PMID:18838740 RGD PMID:18838740 Elovl5 Rat long-chain fatty acid biosynthetic process involved_in IEA UniProtKB:Q8BHI7 and ensembl:ENSMUSP00000034904 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl5 Rat long-chain fatty-acyl-CoA biosynthetic process involved_in IEA UniRule:UR000254918 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Elovl5 Rat positive regulation of fatty acid biosynthetic process involved_in IEA UniProtKB:Q9NYP7 and ensembl:ENSP000003066401600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl5 Rat positive regulation of fatty acid biosynthetic process involved_in ISO ELOVL5 (Homo sapiens) 1624291 PMID:23749231 RGD PMID:23749231 Elovl5 Rat sphingolipid biosynthetic process involved_in IBA CGD:CAL0000190970 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Elovl5 Rat unsaturated fatty acid biosynthetic process involved_in IEA UniPathway:UPA00658 1600115 GO_REF:0000041 UniProt GO_REF:0000041 Elovl5 Rat unsaturated fatty acid biosynthetic process involved_in IEA UniRule:UR000254918 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Elovl5 Rat unsaturated fatty acid biosynthetic process involved_in IEA UniProtKB:Q8BHI7 and ensembl:ENSMUSP00000034904 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl5 Rat unsaturated fatty acid biosynthetic process involved_in ISO Elovl5 (Mus musculus) 1624291 MGI:3847980 PMID:18838740 RGD PMID:18838740 Elovl5 Rat very long-chain fatty acid biosynthetic process involved_in IEA UniRule:UR000254918 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Elovl5 Rat very long-chain fatty acid biosynthetic process involved_in IDA 8554529 PMID:12005057 UniProt Elovl5 Rat very long-chain fatty acid biosynthetic process involved_in ISO ELOVL5 (Homo sapiens) 1624291 PMID:20427700 and PMID:20937905 RGD PMID:20427700 and PMID:20937905 Elovl5 Rat very long-chain fatty acid biosynthetic process involved_in IBA FB:FBgn0034382 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Elovl5 Rat very long-chain fatty acid biosynthetic process involved_in IEA InterPro:IPR033677 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Elovl5 Rat very long-chain fatty acid biosynthetic process involved_in IEA UniProtKB:Q9NYP7 and ensembl:ENSP000003066401600115 GO_REF:0000107 Ensembl GO_REF:0000107
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) acetylsalicylic acid (ISO) acrylamide (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsenous acid (ISO) benzene (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) buspirone (EXP) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) captan (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlormequat chloride (EXP) clobetasol (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) Di-n-hexyl phthalate (ISO) diarsenic trioxide (ISO) dibenzofurans (ISO) Dibutyl phosphate (ISO) dichloroacetic acid (ISO) dorsomorphin (ISO) ethanol (ISO) fentin chloride (EXP) fipronil (EXP) flutamide (EXP) folic acid (ISO) folpet (ISO) FR900359 (ISO) fulvestrant (ISO) genistein (ISO) GW 4064 (ISO) GW 7647 (ISO) hydroquinone (ISO) indometacin (EXP,ISO) inulin (ISO) isotretinoin (ISO) ivermectin (ISO) ketoconazole (ISO) levofloxacin (EXP) levonorgestrel (ISO) methoxychlor (EXP) methylmercury chloride (ISO) miconazole (ISO) mitoxantrone (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodimethylamine (EXP) nefazodone (EXP) nimesulide (EXP) oleic acid (ISO) ozone (ISO) p-toluidine (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) phenylephrine (EXP) phenylmercury acetate (ISO) pirinixic acid (EXP,ISO) pregnenolone 16alpha-carbonitrile (ISO) propiconazole (ISO) rac-lactic acid (ISO) raloxifene (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) sodium dichromate (EXP) testosterone undecanoate (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) tetracycline (ISO) titanium dioxide (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) Triptolide (ISO) valdecoxib (EXP) valproic acid (ISO)
Biological Process
alpha-linolenic acid metabolic process (IEA,ISO) fatty acid biosynthetic process (IEA,ISO) fatty acid derivative biosynthetic process (IEA,ISO) fatty acid elongation, monounsaturated fatty acid (IBA,IEA,ISO,ISS) fatty acid elongation, polyunsaturated fatty acid (IBA,IDA,IEA,ISO) fatty acid elongation, saturated fatty acid (IBA,IEA) fatty acid metabolic process (IEA) linoleic acid metabolic process (IEA,ISO) lipid metabolic process (IEA) long-chain fatty acid biosynthetic process (IEA,ISO) long-chain fatty-acyl-CoA biosynthetic process (IEA) positive regulation of fatty acid biosynthetic process (IEA,ISO) sphingolipid biosynthetic process (IBA) unsaturated fatty acid biosynthetic process (IEA,ISO) very long-chain fatty acid biosynthetic process (IBA,IDA,IEA,ISO)
Elovl5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 87,671,164 - 87,737,618 (+) NCBI GRCr8 mRatBN7.2 8 78,790,846 - 78,857,307 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 78,790,846 - 78,857,284 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 84,316,763 - 84,342,848 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 82,593,410 - 82,619,495 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 80,416,122 - 80,442,207 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 85,220,941 - 85,287,449 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 85,259,982 - 85,285,983 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 84,786,562 - 84,853,064 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 82,922,551 - 82,948,348 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 82,941,604 - 82,967,402 (+) NCBI Celera 8 78,575,885 - 78,600,766 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
ELOVL5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 53,267,404 - 53,348,950 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 53,267,398 - 53,349,179 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 53,132,202 - 53,213,748 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 53,240,155 - 53,321,901 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 53,240,154 - 53,321,901 NCBI Celera 6 54,794,435 - 54,876,099 (-) NCBI Celera Cytogenetic Map 6 p12.1 NCBI HuRef 6 52,964,031 - 53,045,647 (-) NCBI HuRef CHM1_1 6 53,134,061 - 53,215,737 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 53,107,162 - 53,188,820 (-) NCBI T2T-CHM13v2.0
Elovl5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 77,824,647 - 77,891,801 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 77,824,646 - 77,891,801 (+) Ensembl GRCm39 Ensembl GRCm38 9 77,917,365 - 77,984,519 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 77,917,364 - 77,984,519 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 77,765,172 - 77,832,326 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 77,703,052 - 77,770,197 (+) NCBI MGSCv36 mm8 Celera 9 75,090,915 - 75,160,354 (+) NCBI Celera Cytogenetic Map 9 E1 NCBI cM Map 9 43.36 NCBI
Elovl5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 2,747,232 - 2,812,544 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 2,747,232 - 2,812,544 (+) NCBI ChiLan1.0 ChiLan1.0
ELOVL5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 67,738,260 - 67,818,363 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 63,614,887 - 63,694,873 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 52,822,038 - 52,902,122 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 54,457,569 - 54,537,648 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 54,451,887 - 54,485,878 (-) Ensembl panpan1.1 panPan2
ELOVL5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 20,732,641 - 20,807,748 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 20,734,282 - 20,807,739 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 20,629,994 - 20,705,080 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 21,233,696 - 21,308,436 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 21,233,725 - 21,308,442 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 20,735,219 - 20,810,057 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 20,843,290 - 20,918,321 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 20,980,845 - 21,055,936 (-) NCBI UU_Cfam_GSD_1.0
Elovl5
ELOVL5
ELOVL5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 19,227,209 - 19,305,789 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 19,277,593 - 19,307,625 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 53,118,840 - 53,197,198 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Elovl5
.
Predicted Target Of
Count of predictions: 50 Count of miRNA genes: 46 Interacting mature miRNAs: 50 Transcripts: ENSRNOT00000010409 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 10450865 Bw175 Body weight QTL 175 4.1 total fat pad mass (VT:0015008) adipose tissue molecular composition measurement (CMO:0000484) 8 75311777 84531599 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 634332 Pia18 Pristane induced arthritis QTL 18 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 75311938 82925521 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010409 ⟹ ENSRNOP00000010409
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 78,790,846 - 78,857,284 (+) Ensembl Rnor_6.0 Ensembl 8 85,259,982 - 85,285,983 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110892 ⟹ ENSRNOP00000083526
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 78,832,699 - 78,857,284 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115564 ⟹ ENSRNOP00000092513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 78,808,540 - 78,857,284 (+) Ensembl
RefSeq Acc Id:
NM_134382 ⟹ NP_599209
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 87,671,164 - 87,737,618 (+) NCBI mRatBN7.2 8 78,790,846 - 78,857,307 (+) NCBI Rnor_6.0 8 85,259,988 - 85,285,785 (+) NCBI Rnor_5.0 8 84,786,562 - 84,853,064 (+) NCBI RGSC_v3.4 8 82,922,551 - 82,948,348 (+) RGD Celera 8 78,575,885 - 78,600,766 (+) RGD
Sequence:
ATGGAACATTTCGATGCGTCACTCAGTACCTATTTCAGGGCATTACTGGGCCCCCGAGACACACGAGTCAAAGGATGGTTTCTTCTGGACAATTACATCCCTACGTTTGTCTGCTCTGCCATTTATTT
hide sequence
RefSeq Acc Id:
XM_063264837 ⟹ XP_063120907
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 87,683,961 - 87,737,618 (+) NCBI
RefSeq Acc Id:
NP_599209 ⟸ NM_134382
- UniProtKB:
G9BD46 (UniProtKB/Swiss-Prot), Q920L7 (UniProtKB/Swiss-Prot), A0A8I6AI17 (UniProtKB/TrEMBL)
- Sequence:
MEHFDASLSTYFRALLGPRDTRVKGWFLLDNYIPTFVCSAIYLLIVWLGPKYMKNRQPFSCRGILVVYNLGLTLLSLYMFYELVTGVWEGKYNFFCQGTRSAGESDMKVIRVLWWYYFSKLIEFMDTF
hide sequence
Ensembl Acc Id:
ENSRNOP00000010409 ⟸ ENSRNOT00000010409
Ensembl Acc Id:
ENSRNOP00000083526 ⟸ ENSRNOT00000110892
Ensembl Acc Id:
ENSRNOP00000092513 ⟸ ENSRNOT00000115564
RefSeq Acc Id:
XP_063120907 ⟸ XM_063264837
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AI17 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-01-25
Elovl5
ELOVL fatty acid elongase 5
Elovl5
ELOVL family member 5, elongation of long chain fatty acids (yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Elovl5
ELOVL family member 5, elongation of long chain fatty acids (yeast)
rELO1
fatty acid elongase 1
Symbol and Name updated
1299863 APPROVED
2002-08-07
rELO1
fatty acid elongase 1
Symbol and Name status set to provisional
70820 PROVISIONAL
