Symbol:
Fgl1
Name:
fibrinogen-like 1
RGD ID:
620169
Description:
Predicted to enable identical protein binding activity. Predicted to be involved in several processes, including hepatocyte proliferation; negative regulation of T cell activation; and response to stilbenoid. Predicted to act upstream of or within adipose tissue development; cholesterol metabolic process; and regulation of glucose metabolic process. Predicted to be located in extracellular region. Predicted to be active in collagen-containing extracellular matrix and extracellular space. Orthologous to human FGL1 (fibrinogen like 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
fibrinogen-like protein 1; fibrinogen-related protein 1; fibronigen-like protein 1; Frep1; Lfire1; liver fibrinogen-related protein 1; MGC108569
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FGL1 (fibrinogen like 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Fgl1 (fibrinogen-like protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fgl1 (fibrinogen like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FGL1 (fibrinogen like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FGL1 (fibrinogen like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fgl1 (fibrinogen like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FGL1 (fibrinogen like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FGL1 (fibrinogen like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fgl1 (fibrinogen like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
COX7A2 (cytochrome c oxidase subunit 7A2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
FGL1 (fibrinogen like 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fgl1 (fibrinogen-like protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fgl1 (fibrinogen-like 1)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG41520
Alliance
DIOPT (OrthoInspector|SonicParanoid)
Caenorhabditis elegans (roundworm):
T15B7.1
Alliance
DIOPT (Ensembl Compara|InParanoid|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG7668
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG31832
Alliance
DIOPT (Ensembl Compara|InParanoid)
Drosophila melanogaster (fruit fly):
CG6788
Alliance
DIOPT (Ensembl Compara|InParanoid)
Xenopus tropicalis (tropical clawed frog):
fgl1a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 57,824,127 - 57,854,413 (+) NCBI GRCr8 mRatBN7.2 16 51,120,652 - 51,150,907 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 51,120,694 - 51,151,093 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 56,440,596 - 56,470,768 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 59,839,687 - 59,869,895 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 55,074,531 - 55,104,703 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 54,153,086 - 54,188,120 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 54,153,054 - 54,188,181 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 53,866,814 - 53,900,250 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 54,434,779 - 54,465,928 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 54,434,853 - 54,465,998 (+) NCBI Celera 16 49,015,798 - 49,045,955 (+) NCBI Celera Cytogenetic Map 16 q12.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fgl1 Rat (1->4)-beta-D-glucan multiple interactions ISO Fgl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of FGL1 mRNA CTD PMID:36331819 Fgl1 Rat 1,2-dichloroethane increases expression ISO Fgl1 (Mus musculus) 6480464 ethylene dichloride results in increased expression of FGL1 mRNA CTD PMID:28189721 and PMID:28960355 Fgl1 Rat 17alpha-ethynylestradiol increases expression ISO Fgl1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of FGL1 mRNA CTD PMID:17942748 Fgl1 Rat 17alpha-ethynylestradiol multiple interactions ISO Fgl1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FGL1 mRNA CTD PMID:17942748 Fgl1 Rat 17beta-estradiol multiple interactions ISO FGL1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of FGL1 mRNA CTD PMID:20660070 Fgl1 Rat 17beta-estradiol increases expression ISO Fgl1 (Mus musculus) 6480464 Estradiol results in increased expression of FGL1 mRNA CTD PMID:39298647 Fgl1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of FGL1 mRNA CTD PMID:32145629 Fgl1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO Fgl1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Fgl1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Fgl1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FGL1 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to FGL1 promoter] CTD PMID:17942748 and PMID:19654925 Fgl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FGL1 mRNA CTD PMID:32109520 Fgl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Fgl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FGL1 mRNA CTD PMID:26377647 Fgl1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FGL1 mRNA CTD PMID:21215274 Fgl1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Fgl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FGL1 mRNA CTD PMID:16611356 Fgl1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO FGL1 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of FGL1 protein CTD PMID:31675489 Fgl1 Rat 4,4'-sulfonyldiphenol increases expression ISO Fgl1 (Mus musculus) 6480464 bisphenol S results in increased expression of FGL1 mRNA CTD PMID:39298647 Fgl1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of FGL1 mRNA CTD PMID:31881176 Fgl1 Rat aflatoxin B1 affects expression ISO FGL1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of FGL1 protein CTD PMID:20106945 Fgl1 Rat all-trans-retinoic acid decreases expression ISO FGL1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of FGL1 mRNA CTD PMID:23724009 Fgl1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FGL1 mRNA CTD PMID:16483693 Fgl1 Rat arsenous acid multiple interactions ISO FGL1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to FGL1 protein] CTD PMID:26598702 Fgl1 Rat atrazine increases expression ISO FGL1 (Homo sapiens) 6480464 Atrazine results in increased expression of FGL1 mRNA CTD PMID:22378314 Fgl1 Rat benzo[a]pyrene decreases expression ISO FGL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of FGL1 mRNA CTD PMID:22178795 and PMID:32234424 Fgl1 Rat benzo[a]pyrene increases methylation ISO FGL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of FGL1 promoter CTD PMID:27901495 Fgl1 Rat benzo[b]fluoranthene increases expression ISO Fgl1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of FGL1 mRNA CTD PMID:26377693 Fgl1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Fgl1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of FGL1 mRNA CTD PMID:19850644 Fgl1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Fgl1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of FGL1 mRNA CTD PMID:28085963 Fgl1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Fgl1 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of FGL1 mRNA] CTD PMID:19850644 Fgl1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FGL1 mRNA CTD PMID:25181051 and PMID:32145629 Fgl1 Rat bisphenol A decreases expression ISO FGL1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of FGL1 protein CTD PMID:31675489 Fgl1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of FGL1 mRNA CTD PMID:30903817 Fgl1 Rat bisphenol F multiple interactions ISO FGL1 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of FGL1 gene CTD PMID:31601247 Fgl1 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of FGL1 mRNA CTD PMID:12628495 Fgl1 Rat butanal decreases expression ISO FGL1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of FGL1 mRNA CTD PMID:26079696 Fgl1 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of FGL1 promoter CTD PMID:22457795 Fgl1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of FGL1 mRNA CTD PMID:25993096 Fgl1 Rat calcitriol decreases expression ISO FGL1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of FGL1 mRNA CTD PMID:21592394 Fgl1 Rat calcitriol multiple interactions ISO FGL1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of FGL1 mRNA CTD PMID:21592394 Fgl1 Rat calcium silicate increases expression ISO Fgl1 (Mus musculus) 6480464 calcium silicate results in increased expression of FGL1 mRNA CTD PMID:29279043 Fgl1 Rat capsaicin multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of FGL1 protein] more ... CTD PMID:22150557 Fgl1 Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of FGL1 protein CTD PMID:22150557 Fgl1 Rat carbon nanotube increases expression ISO Fgl1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Fgl1 Rat chlordecone increases expression ISO Fgl1 (Mus musculus) 6480464 Chlordecone results in increased expression of FGL1 mRNA CTD PMID:33711761 Fgl1 Rat choline multiple interactions ISO Fgl1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of FGL1 mRNA CTD PMID:20938992 Fgl1 Rat cisplatin decreases expression ISO FGL1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of FGL1 mRNA CTD PMID:27392435 Fgl1 Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of FGL1 mRNA CTD PMID:12851107 Fgl1 Rat clofibrate decreases expression ISO Fgl1 (Mus musculus) 6480464 Clofibrate results in decreased expression of FGL1 mRNA CTD PMID:23811191 Fgl1 Rat clozapine increases expression ISO FGL1 (Homo sapiens) 6480464 Clozapine results in increased expression of FGL1 protein CTD PMID:36482696 Fgl1 Rat cobalt dichloride decreases expression ISO FGL1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of FGL1 mRNA CTD PMID:19376846 Fgl1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of FGL1 mRNA CTD PMID:24386269 Fgl1 Rat copper(II) chloride decreases expression ISO FGL1 (Homo sapiens) 6480464 cupric chloride results in decreased expression of FGL1 mRNA CTD PMID:38568856 Fgl1 Rat copper(II) sulfate decreases expression ISO FGL1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of FGL1 mRNA CTD PMID:19549813 Fgl1 Rat crocidolite asbestos increases expression ISO Fgl1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of FGL1 mRNA CTD PMID:23917077 Fgl1 Rat cyclosporin A increases expression ISO FGL1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of FGL1 mRNA CTD PMID:21632981 Fgl1 Rat cyclosporin A decreases expression ISO FGL1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of FGL1 mRNA CTD PMID:27989131 Fgl1 Rat cyclosporin A affects expression ISO FGL1 (Homo sapiens) 6480464 Cyclosporine affects the expression of FGL1 mRNA CTD PMID:20106945 and PMID:25562108 Fgl1 Rat dextran sulfate increases expression ISO Fgl1 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of FGL1 protein CTD PMID:35999755 Fgl1 Rat diarsenic trioxide multiple interactions ISO FGL1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to FGL1 protein] CTD PMID:26598702 Fgl1 Rat dichloroacetic acid decreases expression ISO Fgl1 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased expression of FGL1 mRNA CTD PMID:28962523 Fgl1 Rat diclofenac increases expression ISO Fgl1 (Mus musculus) 6480464 Diclofenac results in increased expression of FGL1 mRNA CTD PMID:26934552 Fgl1 Rat dicrotophos decreases expression ISO FGL1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of FGL1 mRNA CTD PMID:28302478 Fgl1 Rat epoxiconazole decreases expression ISO Fgl1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of FGL1 mRNA CTD PMID:35436446 Fgl1 Rat fenthion decreases expression ISO Fgl1 (Mus musculus) 6480464 Fenthion results in decreased expression of FGL1 mRNA CTD PMID:34813904 Fgl1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of FGL1 mRNA CTD PMID:24136188 Fgl1 Rat folic acid multiple interactions ISO Fgl1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of FGL1 mRNA CTD PMID:20938992 Fgl1 Rat fulvestrant multiple interactions ISO FGL1 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of FGL1 gene CTD PMID:31601247 Fgl1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of FGL1 gene CTD PMID:22079235 Fgl1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of FGL1 mRNA CTD PMID:25539665 and PMID:26194646 Fgl1 Rat genistein decreases expression ISO Fgl1 (Mus musculus) 6480464 Genistein results in decreased expression of FGL1 mRNA CTD PMID:32186404 Fgl1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of FGL1 mRNA CTD PMID:24136188 Fgl1 Rat inulin multiple interactions ISO Fgl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FGL1 mRNA CTD PMID:36331819 Fgl1 Rat isobutanol multiple interactions ISO FGL1 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of FGL1 mRNA CTD PMID:29432896 Fgl1 Rat L-methionine multiple interactions ISO Fgl1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of FGL1 mRNA CTD PMID:20938992 Fgl1 Rat lead diacetate decreases expression ISO FGL1 (Homo sapiens) 6480464 lead acetate results in decreased expression of FGL1 mRNA CTD PMID:38568856 Fgl1 Rat levofloxacin increases expression EXP 6480464 Levofloxacin results in increased expression of FGL1 mRNA CTD PMID:24136188 Fgl1 Rat lipopolysaccharide increases expression ISO Fgl1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of FGL1 mRNA CTD PMID:27339419 Fgl1 Rat lipopolysaccharide decreases expression ISO FGL1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of FGL1 mRNA CTD PMID:35811015 Fgl1 Rat lipopolysaccharide multiple interactions ISO FGL1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of FGL1 mRNA CTD PMID:35811015 Fgl1 Rat naphthalene increases expression ISO Fgl1 (Mus musculus) 6480464 naphthalene results in increased expression of FGL1 mRNA CTD PMID:18978301 Fgl1 Rat naproxen multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of FGL1 protein] and Naproxen inhibits the reaction [Capsaicin results in increased expression of FGL1 protein] CTD PMID:22150557 Fgl1 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of FGL1 mRNA CTD PMID:24136188 Fgl1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of FGL1 mRNA CTD PMID:33484710 Fgl1 Rat ozone multiple interactions ISO Fgl1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of FGL1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of FGL1 mRNA CTD PMID:27106289 and PMID:34911549 Fgl1 Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of FGL1 mRNA CTD PMID:27638505 Fgl1 Rat paracetamol affects expression ISO Fgl1 (Mus musculus) 6480464 Acetaminophen affects the expression of FGL1 mRNA CTD PMID:17562736 Fgl1 Rat paracetamol decreases expression ISO FGL1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of FGL1 mRNA CTD PMID:29067470 Fgl1 Rat paracetamol increases expression ISO Fgl1 (Mus musculus) 6480464 Acetaminophen results in increased expression of FGL1 mRNA CTD PMID:29246445 Fgl1 Rat paracetamol multiple interactions ISO Fgl1 (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of FGL1 mRNA] CTD PMID:29246445 Fgl1 Rat pentanal decreases expression ISO FGL1 (Homo sapiens) 6480464 pentanal results in decreased expression of FGL1 mRNA CTD PMID:26079696 Fgl1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Fgl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of FGL1 mRNA more ... CTD PMID:36331819 Fgl1 Rat phenobarbital decreases expression ISO Fgl1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of FGL1 mRNA CTD PMID:19270015 Fgl1 Rat pioglitazone multiple interactions ISO Fgl1 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of FGL1 mRNA CTD PMID:27935865 Fgl1 Rat pirinixic acid decreases expression ISO Fgl1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of FGL1 mRNA CTD PMID:23811191 Fgl1 Rat potassium dichromate increases expression ISO Fgl1 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of FGL1 mRNA CTD PMID:23608068 Fgl1 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Fgl1 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of FGL1 mRNA CTD PMID:28903501 Fgl1 Rat progesterone multiple interactions ISO FGL1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of FGL1 mRNA CTD PMID:20660070 Fgl1 Rat propanal decreases expression ISO FGL1 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of FGL1 mRNA CTD PMID:26079696 Fgl1 Rat resveratrol multiple interactions ISO Fgl1 (Mus musculus) 6480464 resveratrol inhibits the reaction [Dietary Fats affects the expression of FGL1 mRNA] CTD PMID:17086191 Fgl1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO FGL1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of FGL1 mRNA CTD PMID:35811015 Fgl1 Rat senecionine decreases expression ISO Fgl1 (Mus musculus) 6480464 senecionine results in decreased expression of FGL1 protein CTD PMID:35357534 Fgl1 Rat serpentine asbestos increases expression ISO Fgl1 (Mus musculus) 6480464 Asbestos and Serpentine results in increased expression of FGL1 mRNA CTD PMID:23917077 Fgl1 Rat silicon dioxide decreases expression ISO FGL1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of FGL1 mRNA CTD PMID:25895662 Fgl1 Rat silicon dioxide increases expression ISO Fgl1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of FGL1 mRNA CTD PMID:23221170 and PMID:29341224 Fgl1 Rat silver atom increases expression ISO Fgl1 (Mus musculus) 6480464 Silver results in increased expression of FGL1 mRNA CTD PMID:27131904 Fgl1 Rat silver(0) increases expression ISO Fgl1 (Mus musculus) 6480464 Silver results in increased expression of FGL1 mRNA CTD PMID:27131904 Fgl1 Rat sodium arsenite decreases expression ISO FGL1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of FGL1 mRNA CTD PMID:29301061 more ... Fgl1 Rat sodium arsenite decreases expression ISO Fgl1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of FGL1 mRNA CTD PMID:33933676 Fgl1 Rat sodium arsenite increases expression ISO Fgl1 (Mus musculus) 6480464 sodium arsenite results in increased expression of FGL1 mRNA CTD PMID:32068019 Fgl1 Rat sodium arsenite increases methylation ISO FGL1 (Homo sapiens) 6480464 sodium arsenite results in increased methylation of FGL1 intron CTD PMID:32844245 Fgl1 Rat sumatriptan multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of FGL1 protein] and Sumatriptan inhibits the reaction [Capsaicin results in increased expression of FGL1 protein] CTD PMID:22150557 Fgl1 Rat testosterone decreases expression ISO FGL1 (Homo sapiens) 6480464 Testosterone results in decreased expression of FGL1 mRNA CTD PMID:21592394 Fgl1 Rat testosterone multiple interactions ISO FGL1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of FGL1 mRNA CTD PMID:21592394 Fgl1 Rat tetrachloromethane increases expression ISO Fgl1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of FGL1 mRNA CTD PMID:27339419 and PMID:31919559 Fgl1 Rat tetrachloromethane multiple interactions ISO Fgl1 (Mus musculus) 6480464 [PANX1 protein co-treated with Carbon Tetrachloride] affects the expression of FGL1 mRNA CTD PMID:29987408 Fgl1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of FGL1 mRNA CTD PMID:23411599 and PMID:34492290 Fgl1 Rat triadimefon increases expression ISO Fgl1 (Mus musculus) 6480464 triadimefon results in increased expression of FGL1 mRNA CTD PMID:16730040 Fgl1 Rat trichloroethene increases expression ISO Fgl1 (Mus musculus) 6480464 Trichloroethylene results in increased expression of FGL1 mRNA CTD PMID:25549359 Fgl1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of FGL1 gene CTD PMID:27618143 Fgl1 Rat trimellitic anhydride affects expression ISO Fgl1 (Mus musculus) 6480464 trimellitic anhydride affects the expression of FGL1 mRNA CTD PMID:19042947 Fgl1 Rat ursodeoxycholic acid affects expression ISO FGL1 (Homo sapiens) 6480464 Ursodeoxycholic Acid affects the expression of FGL1 mRNA CTD PMID:18422935 Fgl1 Rat valproic acid decreases methylation ISO FGL1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of FGL1 gene CTD PMID:29154799 Fgl1 Rat valproic acid affects expression ISO Fgl1 (Mus musculus) 6480464 Valproic Acid affects the expression of FGL1 mRNA CTD PMID:17963808 Fgl1 Rat valproic acid decreases expression ISO FGL1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of FGL1 mRNA CTD PMID:29154799
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromobenzene (EXP) butanal (ISO) cadmium dichloride (EXP) calcitriol (ISO) calcium silicate (ISO) capsaicin (EXP) carbon nanotube (ISO) chlordecone (ISO) choline (ISO) cisplatin (ISO) clofibrate (EXP,ISO) clozapine (ISO) cobalt dichloride (EXP,ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dichloroacetic acid (ISO) diclofenac (ISO) dicrotophos (ISO) epoxiconazole (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) fulvestrant (ISO) furan (EXP) genistein (ISO) glafenine (EXP) inulin (ISO) isobutanol (ISO) L-methionine (ISO) lead diacetate (ISO) levofloxacin (EXP) lipopolysaccharide (ISO) naphthalene (ISO) naproxen (EXP) nefazodone (EXP) nitrofen (EXP) ozone (ISO) p-toluidine (EXP) paracetamol (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pioglitazone (ISO) pirinixic acid (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) propanal (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) senecionine (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sumatriptan (EXP) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) triadimefon (ISO) trichloroethene (EXP,ISO) trimellitic anhydride (ISO) ursodeoxycholic acid (ISO) valproic acid (ISO)
Fgl1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 57,824,127 - 57,854,413 (+) NCBI GRCr8 mRatBN7.2 16 51,120,652 - 51,150,907 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 51,120,694 - 51,151,093 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 56,440,596 - 56,470,768 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 59,839,687 - 59,869,895 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 55,074,531 - 55,104,703 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 54,153,086 - 54,188,120 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 54,153,054 - 54,188,181 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 53,866,814 - 53,900,250 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 54,434,779 - 54,465,928 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 54,434,853 - 54,465,998 (+) NCBI Celera 16 49,015,798 - 49,045,955 (+) NCBI Celera Cytogenetic Map 16 q12.1 NCBI
FGL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 17,864,389 - 17,895,538 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 17,864,380 - 17,910,365 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 17,721,898 - 17,753,047 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 17,766,180 - 17,797,327 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 17,766,181 - 17,797,327 NCBI Celera 8 16,687,655 - 16,718,923 (-) NCBI Celera Cytogenetic Map 8 p22 NCBI HuRef 8 16,265,901 - 16,296,907 (-) NCBI HuRef CHM1_1 8 17,923,349 - 17,954,500 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 18,131,895 - 18,183,454 (-) NCBI T2T-CHM13v2.0
Fgl1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 41,644,471 - 41,671,015 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 41,644,471 - 41,668,193 (-) Ensembl GRCm39 Ensembl GRCm38 8 41,191,434 - 41,217,978 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 41,191,434 - 41,215,156 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 42,276,788 - 42,300,510 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 42,690,251 - 42,713,941 (-) NCBI MGSCv36 mm8 Celera 8 43,821,071 - 43,843,765 (-) NCBI Celera Cytogenetic Map 8 A4 NCBI cM Map 8 23.89 NCBI
Fgl1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955552 1,783,412 - 1,813,935 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955552 1,784,046 - 1,813,935 (+) NCBI ChiLan1.0 ChiLan1.0
FGL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 36,338,681 - 36,384,278 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 12,065,166 - 12,109,854 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 17,083,524 - 17,128,152 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 14,035,855 - 14,066,956 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 14,035,855 - 14,066,956 (-) Ensembl panpan1.1 panPan2
FGL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 41,161,314 - 41,191,282 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 41,161,394 - 41,179,791 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 41,670,263 - 41,700,258 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 43,219,744 - 43,249,744 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 43,219,761 - 43,249,700 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 41,312,415 - 41,342,403 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 41,856,289 - 41,887,835 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 42,051,073 - 42,081,082 (-) NCBI UU_Cfam_GSD_1.0
Fgl1
FGL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 5,547,126 - 5,576,790 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 5,546,931 - 5,596,434 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 6,073,405 - 6,099,351 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FGL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 15,962,625 - 16,016,118 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 15,962,053 - 15,982,336 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666052 26,283,462 - 26,314,767 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fgl1
.
Predicted Target Of
Count of predictions: 17 Count of miRNA genes: 17 Interacting mature miRNAs: 17 Transcripts: ENSRNOT00000014248 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2300163 Bmd64 Bone mineral density QTL 64 5.3 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 16 37752156 82752156 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 1578768 Stresp22 Stress response QTL 22 2.8 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 16 35288870 80288870 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 7205510 Activ5 Activity QTL 5 3.78 0.00028 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 42396345 84729064 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 1298529 Arunc1 Aerobic running capacity QTL 1 4 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 31951520 60148445 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 2293690 Bss45 Bone structure and strength QTL 45 5.13 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 16 37752156 82752156 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
4
8
13
45
79
84
53
17
53
6
135
43
29
27
37
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014248 ⟹ ENSRNOP00000014248
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 51,120,694 - 51,150,905 (+) Ensembl Rnor_6.0 Ensembl 16 54,153,086 - 54,188,118 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000090644 ⟹ ENSRNOP00000073912
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 51,120,694 - 51,151,093 (+) Ensembl Rnor_6.0 Ensembl 16 54,153,054 - 54,188,181 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000090763 ⟹ ENSRNOP00000075300
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 51,120,694 - 51,147,104 (+) Ensembl Rnor_6.0 Ensembl 16 54,164,431 - 54,184,559 (+) Ensembl
RefSeq Acc Id:
NM_172010 ⟹ NP_742007
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 57,824,200 - 57,854,408 (+) NCBI mRatBN7.2 16 51,120,694 - 51,150,907 (+) NCBI Rnor_6.0 16 54,153,086 - 54,188,120 (+) NCBI Rnor_5.0 16 53,866,814 - 53,900,250 (+) NCBI RGSC_v3.4 16 54,434,779 - 54,465,928 (+) RGD Celera 16 49,015,798 - 49,045,955 (+) RGD
Sequence:
GGCCATTACGGCCGGGGGACTTCAGTTAGAAGTTCCTGGGAGGCCCTGTGTAGACCCAGCCTAGCTGAGTACTGATTCATTTTGATGTGAGTGGGAAGAATGGGGGAGATTCGCAGCTTTGTCCTCAT
hide sequence
RefSeq Acc Id:
XM_039094195 ⟹ XP_038950123
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 57,824,127 - 57,854,413 (+) NCBI mRatBN7.2 16 51,120,652 - 51,150,811 (+) NCBI
RefSeq Acc Id:
NP_742007 ⟸ NM_172010
- Peptide Label:
precursor
- UniProtKB:
Q5M8C6 (UniProtKB/Swiss-Prot), A6JPU2 (UniProtKB/TrEMBL), Q8K583 (UniProtKB/TrEMBL)
- Sequence:
MGEIRSFVLITVALILGKESWVLGDENCLQEQVRLRAQVRQLETRVKQQQVVIAQLLHEKEVQFLDRGQEDSFIDLGGKRHYADCSEIYNDGFKHSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRR
hide sequence
Ensembl Acc Id:
ENSRNOP00000073912 ⟸ ENSRNOT00000090644
Ensembl Acc Id:
ENSRNOP00000075300 ⟸ ENSRNOT00000090763
Ensembl Acc Id:
ENSRNOP00000014248 ⟸ ENSRNOT00000014248
RefSeq Acc Id:
XP_038950123 ⟸ XM_039094195
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2R9U7 (UniProtKB/TrEMBL), Q8K583 (UniProtKB/TrEMBL)
RGD ID: 13700118 Promoter ID: EPDNEW_R10641 Type: initiation region Name: Fgl1_1 Description: fibrinogen-like 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 54,153,086 - 54,153,146 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-19
Fgl1
fibrinogen-like 1
Fgl1
fibronigen-like protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Fgl1
fibronigen-like protein 1
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Fgl1
fibronigen-like protein 1
Symbol and Name status set to provisional
70820 PROVISIONAL
