Symbol:
Il12rb1
Name:
interleukin 12 receptor subunit beta 1
RGD ID:
620025
Description:
Predicted to enable coreceptor activity; cytokine binding activity; and cytokine receptor activity. Predicted to contribute to cytokine receptor activity; interleukin-12 receptor binding activity; and interleukin-23 binding activity. Predicted to be involved in several processes, including cellular response to cytokine stimulus; positive regulation of activated T cell proliferation; and positive regulation of defense response to virus by host. Predicted to act upstream of or within peptidyl-tyrosine phosphorylation. Predicted to be part of interleukin-12 receptor complex and interleukin-23 receptor complex. Predicted to be active in external side of plasma membrane. Biomarker of primary biliary cholangitis. Human ortholog(s) of this gene implicated in immunodeficiency 30. Orthologous to human IL12RB1 (interleukin 12 receptor subunit beta 1); PARTICIPATES IN interleukin-12 signaling pathway; interleukin-23 signaling pathway; interleukin-27 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Il12rb; interleukin 12 receptor, beta 1; interleukin-12 receptor subunit beta-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IL12RB1 (interleukin 12 receptor subunit beta 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Il12rb1 (interleukin 12 receptor, beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Il12rb1 (interleukin 12 receptor subunit beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
IL12RB1 (interleukin 12 receptor subunit beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IL12RB1 (interleukin 12 receptor subunit beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Il12rb1 (interleukin 12 receptor subunit beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
IL12RB1 (interleukin 12 receptor subunit beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IL12RB1 (interleukin 12 receptor subunit beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Il12rb1 (interleukin 12 receptor subunit beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
IL12RB1 (interleukin 12 receptor subunit beta 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Il12rb1 (interleukin 12 receptor, beta 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-13m1.2
Alliance
DIOPT (Hieranoid|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,654,207 - 18,668,887 (-) NCBI GRCr8 mRatBN7.2 16 18,620,228 - 18,633,207 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,620,770 - 18,632,769 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,662,883 - 18,675,076 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 19,795,557 - 19,807,750 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 18,715,823 - 18,728,017 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 20,370,722 - 20,383,576 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 20,371,338 - 20,383,337 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 20,227,894 - 20,240,670 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 19,126,653 - 19,137,584 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 19,126,957 - 19,128,305 (-) NCBI Celera 16 18,812,772 - 18,825,080 (-) NCBI Celera Cytogenetic Map 16 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Il12rb1 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO Il12rb1 (Mus musculus) 6480464 Dinitrochlorobenzene results in increased expression of IL12RB1 mRNA CTD PMID:18242016 and PMID:21404309 Il12rb1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Il12rb1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of IL12RB1 mRNA CTD PMID:17337447 and PMID:20159946 Il12rb1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IL12RB1 mRNA CTD PMID:34747641 Il12rb1 Rat 2,4-diaminotoluene increases expression ISO Il12rb1 (Mus musculus) 6480464 2 and 4-diaminotoluene results in increased expression of IL12RB1 mRNA CTD PMID:20713471 Il12rb1 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Il12rb1 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Il12rb1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO Il12rb1 (Mus musculus) 6480464 tetrabromobisphenol A results in increased expression of IL12RB1 mRNA CTD PMID:25172293 Il12rb1 Rat 3-methylcholanthrene increases expression ISO Il12rb1 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of IL12RB1 mRNA CTD PMID:20713471 Il12rb1 Rat 4,4'-diaminodiphenylmethane affects expression ISO Il12rb1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of IL12RB1 mRNA CTD PMID:18648102 Il12rb1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO IL12RB1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of IL12RB1 gene CTD PMID:38338858 Il12rb1 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO Il12rb1 (Mus musculus) 6480464 Oxazolone results in increased expression of IL12RB1 mRNA CTD PMID:18242016 and PMID:21404309 Il12rb1 Rat 4-hydroxynon-2-enal decreases expression ISO IL12RB1 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of IL12RB1 mRNA CTD PMID:12419474 Il12rb1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of IL12RB1 mRNA CTD PMID:31881176 Il12rb1 Rat acrolein increases expression ISO Il12rb1 (Mus musculus) 6480464 Acrolein results in increased expression of IL12RB1 mRNA CTD PMID:18515264 Il12rb1 Rat aflatoxin B1 affects methylation ISO IL12RB1 (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of IL12RB1 intron CTD PMID:30157460 Il12rb1 Rat aflatoxin B1 increases methylation ISO IL12RB1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of IL12RB1 promoter CTD PMID:30157460 Il12rb1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of IL12RB1 mRNA CTD PMID:16483693 Il12rb1 Rat antirheumatic drug decreases expression ISO IL12RB1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of IL12RB1 mRNA CTD PMID:24449571 Il12rb1 Rat arsane affects methylation ISO IL12RB1 (Homo sapiens) 6480464 Arsenic affects the methylation of IL12RB1 gene CTD PMID:25304211 Il12rb1 Rat arsenic atom affects methylation ISO IL12RB1 (Homo sapiens) 6480464 Arsenic affects the methylation of IL12RB1 gene CTD PMID:25304211 Il12rb1 Rat benzo[a]pyrene increases expression ISO Il12rb1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of IL12RB1 mRNA CTD PMID:20713471 and PMID:27195522 Il12rb1 Rat benzo[a]pyrene affects methylation ISO IL12RB1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of IL12RB1 intron and Benzo(a)pyrene affects the methylation of IL12RB1 promoter CTD PMID:27901495 and PMID:30157460 Il12rb1 Rat benzo[e]pyrene increases methylation ISO IL12RB1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of IL12RB1 promoter CTD PMID:30157460 Il12rb1 Rat bis(2-chloroethyl) sulfide increases expression ISO Il12rb1 (Mus musculus) 6480464 Mustard Gas results in increased expression of IL12RB1 mRNA CTD PMID:19778212 Il12rb1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IL12RB1 mRNA CTD PMID:25181051 Il12rb1 Rat bisphenol A decreases methylation ISO IL12RB1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of IL12RB1 gene CTD PMID:38338858 Il12rb1 Rat bisphenol F decreases methylation ISO IL12RB1 (Homo sapiens) 6480464 bisphenol F results in decreased methylation of IL12RB1 gene CTD PMID:38338858 Il12rb1 Rat cadmium dichloride increases expression ISO IL12RB1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of IL12RB1 mRNA CTD PMID:38568856 Il12rb1 Rat Calcimycin multiple interactions ISO IL12RB1 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of IL12RB1 mRNA and fulvic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of IL12RB1 mRNA] CTD PMID:21331654 Il12rb1 Rat carbon nanotube increases expression ISO Il12rb1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Il12rb1 Rat chlorophyllin multiple interactions ISO Il12rb1 (Mus musculus) 6480464 chlorophyllin inhibits the reaction [Lipopolysaccharides results in increased expression of IL12RB1 mRNA] CTD PMID:16275627 Il12rb1 Rat choline multiple interactions ISO Il12rb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of IL12RB1 gene CTD PMID:20938992 Il12rb1 Rat cisplatin increases expression ISO IL12RB1 (Homo sapiens) 6480464 Cisplatin results in increased expression of IL12RB1 mRNA CTD PMID:27392435 Il12rb1 Rat dexamethasone decreases expression ISO IL12RB1 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of IL12RB1 protein CTD PMID:9743329 Il12rb1 Rat Dibutyl phosphate affects expression ISO IL12RB1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of IL12RB1 mRNA CTD PMID:37042841 Il12rb1 Rat diclofenac increases expression EXP 6480464 Diclofenac results in increased expression of IL12RB1 mRNA CTD PMID:30723492 Il12rb1 Rat ethyl methanesulfonate increases expression ISO IL12RB1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of IL12RB1 mRNA CTD PMID:23649840 Il12rb1 Rat fluoranthene multiple interactions ISO Il12rb1 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of IL12RB1 mRNA CTD PMID:28329830 Il12rb1 Rat folic acid multiple interactions ISO Il12rb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of IL12RB1 gene CTD PMID:20938992 Il12rb1 Rat formaldehyde increases expression ISO IL12RB1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of IL12RB1 mRNA CTD PMID:23649840 Il12rb1 Rat Fulvic acid multiple interactions ISO IL12RB1 (Homo sapiens) 6480464 fulvic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of IL12RB1 mRNA] CTD PMID:21331654 Il12rb1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of IL12RB1 mRNA CTD PMID:21396975 Il12rb1 Rat L-methionine multiple interactions ISO Il12rb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of IL12RB1 gene CTD PMID:20938992 Il12rb1 Rat lipopolysaccharide multiple interactions ISO Il12rb1 (Mus musculus) 6480464 chlorophyllin inhibits the reaction [Lipopolysaccharides results in increased expression of IL12RB1 mRNA] CTD PMID:16275627 Il12rb1 Rat methapyrilene increases methylation ISO IL12RB1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of IL12RB1 promoter CTD PMID:30157460 Il12rb1 Rat methotrexate affects expression ISO Il12rb1 (Mus musculus) 6480464 Methotrexate affects the expression of IL12RB1 mRNA CTD PMID:18502557 Il12rb1 Rat methyl methanesulfonate increases expression ISO IL12RB1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of IL12RB1 mRNA CTD PMID:23649840 Il12rb1 Rat microcystin-LR increases expression ISO Il12rb1 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of IL12RB1 mRNA CTD PMID:37342990 Il12rb1 Rat nickel atom increases expression ISO IL12RB1 (Homo sapiens) 6480464 Nickel results in increased expression of IL12RB1 mRNA CTD PMID:25583101 Il12rb1 Rat paracetamol decreases expression ISO IL12RB1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of IL12RB1 mRNA CTD PMID:26690555 Il12rb1 Rat phorbol 13-acetate 12-myristate increases expression ISO IL12RB1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of IL12RB1 protein CTD PMID:11441113 Il12rb1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO IL12RB1 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of IL12RB1 mRNA and fulvic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of IL12RB1 mRNA] CTD PMID:21331654 Il12rb1 Rat pirinixic acid multiple interactions ISO Il12rb1 (Mus musculus) 6480464 NCF1 protein promotes the reaction [pirinixic acid results in decreased expression of IL12RB1 mRNA] CTD PMID:17950772 Il12rb1 Rat pirinixic acid decreases expression ISO Il12rb1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of IL12RB1 mRNA CTD PMID:17950772 and PMID:20813756 Il12rb1 Rat prenyl diphosphate increases expression ISO IL12RB1 (Homo sapiens) 6480464 3 and 3-dimethylallyl pyrophosphate results in increased expression of IL12RB1 protein CTD PMID:12932289 Il12rb1 Rat prostaglandin E2 decreases expression ISO IL12RB1 (Homo sapiens) 6480464 Dinoprostone results in decreased expression of IL12RB1 protein CTD PMID:9743329 Il12rb1 Rat sevoflurane decreases methylation ISO Il12rb1 (Mus musculus) 6480464 Sevoflurane results in decreased methylation of IL12RB1 mRNA CTD PMID:35249202 Il12rb1 Rat silicon dioxide increases expression ISO Il12rb1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of IL12RB1 mRNA CTD PMID:29341224 Il12rb1 Rat tamoxifen increases expression ISO Il12rb1 (Mus musculus) 6480464 Tamoxifen results in increased expression of IL12RB1 mRNA CTD PMID:25123088 Il12rb1 Rat titanium dioxide decreases methylation ISO Il12rb1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of IL12RB1 gene and titanium dioxide results in decreased methylation of IL12RB1 promoter CTD PMID:35295148 Il12rb1 Rat toluene 2,4-diisocyanate increases expression ISO Il12rb1 (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in increased expression of IL12RB1 mRNA CTD PMID:18242016 and PMID:21404309 Il12rb1 Rat trichloroethene decreases expression ISO Il12rb1 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of IL12RB1 mRNA CTD PMID:25549359 Il12rb1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of IL12RB1 mRNA CTD PMID:33387578 Il12rb1 Rat trimellitic anhydride increases expression ISO Il12rb1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of IL12RB1 mRNA CTD PMID:19042947 Il12rb1 Rat valproic acid affects expression ISO Il12rb1 (Mus musculus) 6480464 Valproic Acid affects the expression of IL12RB1 mRNA CTD PMID:17963808
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1-chloro-2,4-dinitrobenzene (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-hydroxynon-2-enal (ISO) acetamide (EXP) acrolein (ISO) aflatoxin B1 (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) Calcimycin (ISO) carbon nanotube (ISO) chlorophyllin (ISO) choline (ISO) cisplatin (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) diclofenac (EXP) ethyl methanesulfonate (ISO) fluoranthene (ISO) folic acid (ISO) formaldehyde (ISO) Fulvic acid (ISO) indole-3-methanol (EXP) L-methionine (ISO) lipopolysaccharide (ISO) methapyrilene (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) microcystin-LR (ISO) nickel atom (ISO) paracetamol (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) prenyl diphosphate (ISO) prostaglandin E2 (ISO) sevoflurane (ISO) silicon dioxide (ISO) tamoxifen (ISO) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) trichloroethene (EXP,ISO) trimellitic anhydride (ISO) valproic acid (ISO)
Il12rb1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,654,207 - 18,668,887 (-) NCBI GRCr8 mRatBN7.2 16 18,620,228 - 18,633,207 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,620,770 - 18,632,769 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,662,883 - 18,675,076 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 19,795,557 - 19,807,750 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 18,715,823 - 18,728,017 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 20,370,722 - 20,383,576 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 20,371,338 - 20,383,337 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 20,227,894 - 20,240,670 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 19,126,653 - 19,137,584 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 19,126,957 - 19,128,305 (-) NCBI Celera 16 18,812,772 - 18,825,080 (-) NCBI Celera Cytogenetic Map 16 p14 NCBI
IL12RB1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 18,058,995 - 18,098,816 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 18,058,995 - 18,098,944 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 18,169,805 - 18,209,626 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 18,031,371 - 18,058,697 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 18,042,372 - 18,058,697 NCBI Celera 19 18,072,103 - 18,099,423 (-) NCBI Celera Cytogenetic Map 19 p13.11 NCBI HuRef 19 17,735,230 - 17,761,934 (-) NCBI HuRef CHM1_1 19 18,169,971 - 18,197,251 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 18,193,086 - 18,232,890 (-) NCBI T2T-CHM13v2.0
Il12rb1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 71,261,005 - 71,276,186 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 71,261,093 - 71,274,068 (+) Ensembl GRCm39 Ensembl GRCm38 8 70,808,360 - 70,823,542 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 70,808,449 - 70,821,424 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 73,332,348 - 73,345,323 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 73,737,483 - 73,750,411 (+) NCBI MGSCv36 mm8 Celera 8 73,369,767 - 73,382,761 (+) NCBI Celera Cytogenetic Map 8 B3.3 NCBI cM Map 8 34.21 NCBI
Il12rb1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955524 3,276,932 - 3,299,617 (+) NCBI ChiLan1.0 ChiLan1.0
IL12RB1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 22,918,044 - 22,948,967 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 21,925,488 - 21,957,313 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 17,536,709 - 17,547,665 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 18,513,585 - 18,541,383 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 18,513,585 - 18,541,383 (-) Ensembl panpan1.1 panPan2
IL12RB1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 44,885,410 - 44,908,139 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 44,885,337 - 44,904,538 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 44,798,850 - 44,821,426 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 45,370,928 - 45,393,501 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 45,370,906 - 45,389,856 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 44,608,042 - 44,630,592 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 45,018,340 - 45,040,923 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 45,294,319 - 45,317,108 (+) NCBI UU_Cfam_GSD_1.0
Il12rb1
IL12RB1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 59,707,961 - 59,736,282 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 59,707,958 - 59,736,282 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 59,276,610 - 59,305,011 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IL12RB1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 16,527,392 - 16,557,250 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 16,528,271 - 16,556,840 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 2,834,014 - 2,850,939 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Il12rb1
.
Predicted Target Of
Count of predictions: 57 Count of miRNA genes: 46 Interacting mature miRNAs: 54 Transcripts: ENSRNOT00000025977 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 631517 Scl9 Serum cholesterol level QTL 9 3.3 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 16 15726433 21034895 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 1600369 Hcas8 Hepatocarcinoma susceptibility QTL 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 16 1 22477621 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 1300133 Rf24 Renal function QTL 24 3.64 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 16 3380150 21361552 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
7
19
50
60
59
28
25
28
6
152
64
30
45
52
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025977 ⟹ ENSRNOP00000025977
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 18,620,770 - 18,632,769 (-) Ensembl Rnor_6.0 Ensembl 16 20,371,338 - 20,383,337 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106514 ⟹ ENSRNOP00000080150
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 18,620,770 - 18,632,769 (-) Ensembl
RefSeq Acc Id:
NM_001170604 ⟹ NP_001164075
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,654,207 - 18,666,824 (-) NCBI mRatBN7.2 16 18,620,228 - 18,632,845 (-) NCBI Rnor_6.0 16 20,371,338 - 20,383,337 (-) NCBI Rnor_5.0 16 20,227,894 - 20,240,670 (-) NCBI Celera 16 18,812,772 - 18,825,080 (-) NCBI
Sequence:
ATGGACATGACGGGGCTGCCAGGGACCAGCAAGCACATCATCTTCCTCCTGCTTTGCCAGCTAAGCGCCTCCAGCCGAGGTGACAGCTGCTGCGTTGAGAAGATATCATACCCAGATGAAGCCTCAGG
hide sequence
RefSeq Acc Id:
XM_006252821 ⟹ XP_006252883
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,654,207 - 18,668,886 (-) NCBI mRatBN7.2 16 18,620,228 - 18,633,207 (-) NCBI Rnor_6.0 16 20,370,722 - 20,383,576 (-) NCBI Rnor_5.0 16 20,227,894 - 20,240,670 (-) NCBI
Sequence:
TTCCAGGCTTACTTACCCAGTGTCAGTGTGTTTCCGAGTGCTGACAAGGTGGCAGGGCCCCTTC
hide sequence
RefSeq Acc Id:
XR_010058275
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,655,894 - 18,668,887 (-) NCBI
RefSeq Acc Id:
NP_001164075 ⟸ NM_001170604
- Peptide Label:
precursor
- UniProtKB:
E9PSU7 (UniProtKB/TrEMBL)
- Sequence:
MDMTGLPGTSKHIIFLLLCQLSASSRGDSCCVEKISYPDEASGPSLGPRDLSCYRVSGTDYECSWQYDGPEDNVAHFLWCCFAHPNPTHTSFGQECCCYFSSGRSRTVQFWEQDGISTLSKVNFWVES
hide sequence
RefSeq Acc Id:
XP_006252883 ⟸ XM_006252821
- Peptide Label:
isoform X1
- UniProtKB:
E9PSU7 (UniProtKB/TrEMBL)
- Sequence:
MDMTGLPGTSKHIIFLLLCQLSASSRGDSCCVEKISYPDEASGPSLGPRDLSCYRVSGTDYECSWQYDGPEDNVAHFLWCCFAHPNPTHTSFGQECCCYFSSGRSRTVQFWEQDGISTLSKVNFWVES
hide sequence
Ensembl Acc Id:
ENSRNOP00000025977 ⟸ ENSRNOT00000025977
Ensembl Acc Id:
ENSRNOP00000080150 ⟸ ENSRNOT00000106514
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-16
Il12rb1
interleukin 12 receptor subunit beta 1
Il12rb1
interleukin 12 receptor, beta 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Il12rb1
interleukin 12 receptor, beta 1
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Il12rb1
interleukin 12 receptor, beta 1
Symbol and Name status set to provisional
70820 PROVISIONAL
