Symbol:
P2ry4
Name:
pyrimidinergic receptor P2Y4
RGD ID:
61798
Description:
Enables ATP binding activity. Involved in regulation of presynaptic cytosolic calcium ion concentration and regulation of synaptic vesicle exocytosis. Located in apical plasma membrane and basolateral plasma membrane. Is active in glutamatergic synapse and presynaptic active zone membrane. Orthologous to human P2RY4 (pyrimidinergic receptor P2Y4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
P2Y ATP receptor 4; P2Y purinoceptor 4; P2Y4; purinergic receptor P2Y G-protein coupled 4; purinergic receptor P2Y, G-protein coupled 4; pyrimidinergic receptor P2Y G-protein coupled 4; pyrimidinergic receptor P2Y, G-protein coupled, 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
P2RY4 (pyrimidinergic receptor P2Y4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
P2ry4 (pyrimidinergic receptor P2Y, G-protein coupled, 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
P2ry4 (pyrimidinergic receptor P2Y4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
P2RY4 (pyrimidinergic receptor P2Y4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
P2RY4 (pyrimidinergic receptor P2Y4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
P2ry4 (pyrimidinergic receptor P2Y4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
P2RY4 (pyrimidinergic receptor P2Y4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
P2RY4 (pyrimidinergic receptor P2Y4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
P2ry4 (pyrimidinergic receptor P2Y4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
P2ry4 (pyrimidinergic receptor P2Y, G-protein coupled, 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
P2RY4 (pyrimidinergic receptor P2Y4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
p2ry2.2 (purinergic receptor P2Y2, tandem duplicate 2)
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
p2ry4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 69,722,604 - 69,757,726 (-) NCBI GRCr8 mRatBN7.2 X 65,681,680 - 65,717,404 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 65,683,232 - 65,721,748 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 67,170,441 - 67,171,854 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 70,670,833 - 70,672,246 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 68,231,732 - 68,233,145 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 70,421,599 - 70,447,109 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 70,426,951 - 70,428,364 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 71,296,545 - 71,329,324 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 88,589,534 - 88,590,947 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 88,662,966 - 88,664,380 (-) NCBI Celera X 66,045,899 - 66,047,312 (-) NCBI Celera Cytogenetic Map X q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
P2ry4 Rat (1->4)-beta-D-glucan multiple interactions ISO P2ry4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of P2RY4 mRNA CTD PMID:36331819 P2ry4 Rat 17beta-estradiol decreases expression ISO P2ry4 (Mus musculus) 6480464 Estradiol results in decreased expression of P2RY4 mRNA CTD PMID:39298647 P2ry4 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO P2ry4 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 P2ry4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO P2ry4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of P2RY4 mRNA CTD PMID:26377647 P2ry4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of P2RY4 mRNA CTD PMID:33387578 P2ry4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO P2ry4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of P2RY4 mRNA CTD PMID:25975270 and PMID:26290441 P2ry4 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of P2RY4 mRNA CTD PMID:21346803 P2ry4 Rat 4,4'-sulfonyldiphenol decreases expression ISO P2ry4 (Mus musculus) 6480464 bisphenol S results in decreased expression of P2RY4 mRNA CTD PMID:39298647 P2ry4 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of P2RY4 mRNA CTD PMID:31881176 P2ry4 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of P2RY4 mRNA CTD PMID:28959563 P2ry4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of P2RY4 mRNA CTD PMID:16483693 P2ry4 Rat ATP multiple interactions ISO P2RY4 (Homo sapiens) 6480464 [Adenosine Triphosphate binds to and results in increased activity of P2RY4 protein] which results in increased abundance of Calcium more ... CTD PMID:12694404 P2ry4 Rat Azoxymethane multiple interactions ISO P2ry4 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of P2RY4 mRNA CTD PMID:29950665 P2ry4 Rat benzo[a]pyrene decreases expression ISO P2RY4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of P2RY4 mRNA CTD PMID:22316170 P2ry4 Rat benzo[a]pyrene affects methylation ISO P2RY4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of P2RY4 promoter CTD PMID:27901495 P2ry4 Rat benzo[a]pyrene decreases methylation ISO P2RY4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of P2RY4 exon CTD PMID:27901495 P2ry4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of P2RY4 mRNA CTD PMID:25181051 P2ry4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of P2RY4 mRNA CTD PMID:30816183 more ... P2ry4 Rat bisphenol F increases expression ISO P2ry4 (Mus musculus) 6480464 bisphenol F results in increased expression of P2RY4 mRNA CTD PMID:38685157 P2ry4 Rat calcium atom multiple interactions ISO P2RY4 (Homo sapiens) 6480464 [Adenosine Triphosphate binds to and results in increased activity of P2RY4 protein] which results in increased abundance of Calcium and Trichloroethylene inhibits the reaction [[Adenosine Triphosphate binds to and results in increased activity of P2RY4 protein] which results in increased abundance of Calcium] CTD PMID:12694404 P2ry4 Rat calcium(0) multiple interactions ISO P2RY4 (Homo sapiens) 6480464 [Adenosine Triphosphate binds to and results in increased activity of P2RY4 protein] which results in increased abundance of Calcium and Trichloroethylene inhibits the reaction [[Adenosine Triphosphate binds to and results in increased activity of P2RY4 protein] which results in increased abundance of Calcium] CTD PMID:12694404 P2ry4 Rat CGP 52608 multiple interactions ISO P2RY4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to P2RY4 gene] CTD PMID:28238834 P2ry4 Rat dextran sulfate multiple interactions ISO P2ry4 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of P2RY4 mRNA CTD PMID:29950665 P2ry4 Rat disodium selenite decreases expression ISO P2RY4 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of P2RY4 mRNA CTD PMID:18175754 P2ry4 Rat epoxiconazole decreases expression ISO P2ry4 (Mus musculus) 6480464 epoxiconazole results in decreased expression of P2RY4 mRNA CTD PMID:35436446 P2ry4 Rat ethanol multiple interactions ISO P2ry4 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of P2RY4 mRNA CTD PMID:30517762 P2ry4 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of P2RY4 mRNA CTD PMID:30307764 P2ry4 Rat fonofos increases methylation ISO P2RY4 (Homo sapiens) 6480464 Fonofos results in increased methylation of P2RY4 promoter CTD PMID:22847954 P2ry4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of P2RY4 mRNA CTD PMID:33387578 P2ry4 Rat GTP multiple interactions EXP 6480464 Guanosine Triphosphate binds to and results in increased activity of P2RY4 protein CTD PMID:15654852 P2ry4 Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of P2RY4 mRNA CTD PMID:19244398 P2ry4 Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of P2RY4 mRNA CTD PMID:19244398 P2ry4 Rat maneb multiple interactions ISO P2ry4 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of P2RY4 mRNA and Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of P2RY4 mRNA] CTD PMID:23963992 P2ry4 Rat melatonin multiple interactions ISO P2ry4 (Mus musculus) 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of P2RY4 mRNA] CTD PMID:23963992 P2ry4 Rat N-(3-oxododecanoyl)homoserine lactone decreases expression ISO P2RY4 (Homo sapiens) 6480464 N-(3-oxododecanoyl)homoserine lactone results in decreased expression of P2RY4 mRNA CTD PMID:10496880 P2ry4 Rat paracetamol affects expression ISO P2ry4 (Mus musculus) 6480464 Acetaminophen affects the expression of P2RY4 mRNA CTD PMID:17562736 P2ry4 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of P2RY4 mRNA CTD PMID:33387578 P2ry4 Rat paraquat multiple interactions ISO P2ry4 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of P2RY4 mRNA and Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of P2RY4 mRNA] CTD PMID:23963992 P2ry4 Rat parathion increases methylation ISO P2RY4 (Homo sapiens) 6480464 Parathion results in increased methylation of P2RY4 promoter CTD PMID:22847954 P2ry4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO P2ry4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of P2RY4 mRNA CTD PMID:36331819 P2ry4 Rat pirinixic acid decreases expression ISO P2ry4 (Mus musculus) 6480464 pirinixic acid results in decreased expression of P2RY4 mRNA CTD PMID:17950772 P2ry4 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO P2ry4 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of P2RY4 mRNA CTD PMID:28903501 P2ry4 Rat tamoxifen decreases expression ISO P2ry4 (Mus musculus) 6480464 Tamoxifen results in decreased expression of P2RY4 mRNA CTD PMID:25123088 P2ry4 Rat terbufos increases methylation ISO P2RY4 (Homo sapiens) 6480464 terbufos results in increased methylation of P2RY4 promoter CTD PMID:22847954 P2ry4 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of P2RY4 mRNA CTD PMID:12734012 P2ry4 Rat tetrachloromethane multiple interactions ISO P2ry4 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of P2RY4 mRNA CTD PMID:30517762 P2ry4 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of P2RY4 mRNA CTD PMID:31150632 P2ry4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of P2RY4 mRNA CTD PMID:23411599 P2ry4 Rat titanium dioxide increases expression ISO P2ry4 (Mus musculus) 6480464 titanium dioxide results in increased expression of P2RY4 mRNA CTD PMID:29264374 P2ry4 Rat titanium dioxide multiple interactions ISO P2ry4 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of P2RY4 mRNA CTD PMID:29950665 P2ry4 Rat trichloroethene multiple interactions ISO P2RY4 (Homo sapiens) 6480464 Trichloroethylene inhibits the reaction [[Adenosine Triphosphate binds to and results in increased activity of P2RY4 protein] which results in increased abundance of Calcium] CTD PMID:12694404 P2ry4 Rat trichloroethene decreases activity ISO P2RY4 (Homo sapiens) 6480464 Trichloroethylene results in decreased activity of P2RY4 protein CTD PMID:12694404 P2ry4 Rat triptonide increases expression ISO P2ry4 (Mus musculus) 6480464 triptonide results in increased expression of P2RY4 mRNA CTD PMID:33045310 P2ry4 Rat UTP multiple interactions EXP 6480464 Uridine Triphosphate binds to and results in increased activity of P2RY4 protein CTD PMID:15654852 P2ry4 Rat valproic acid increases methylation ISO P2RY4 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of P2RY4 gene CTD PMID:29154799
(1->4)-beta-D-glucan (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrylamide (EXP) ammonium chloride (EXP) ATP (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) bisphenol F (ISO) calcium atom (ISO) calcium(0) (ISO) CGP 52608 (ISO) dextran sulfate (ISO) disodium selenite (ISO) epoxiconazole (ISO) ethanol (ISO) fenvalerate (EXP) fonofos (ISO) gentamycin (EXP) GTP (EXP) lithium atom (EXP) lithium hydride (EXP) maneb (ISO) melatonin (ISO) N-(3-oxododecanoyl)homoserine lactone (ISO) paracetamol (EXP,ISO) paraquat (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) tamoxifen (ISO) terbufos (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (ISO) triptonide (ISO) UTP (EXP) valproic acid (ISO)
1.
Molecular cloning and characterization of rat P2Y4 nucleotide receptor.
Bogdanov YD, etal., Br J Pharmacol 1998 Jun;124(3):428-30.
2.
Polarized expression and function of P2Y ATP receptors in rat bile duct epithelia.
Dranoff JA, etal., Am J Physiol Gastrointest Liver Physiol 2001 Oct;281(4):G1059-67.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Dual presynaptic control by ATP of glutamate release via facilitatory P2X1, P2X2/3, and P2X3 and inhibitory P2Y1, P2Y2, and/or P2Y4 receptors in the rat hippocampus.
Rodrigues RJ, etal., J Neurosci. 2005 Jul 6;25(27):6286-95.
10.
Molecular cloning and characterization of the mouse P2Y4 nucleotide receptor.
Suarez-Huerta N, etal., Eur J Pharmacol 2001 Mar 30;416(3):197-202.
11.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
P2ry4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 69,722,604 - 69,757,726 (-) NCBI GRCr8 mRatBN7.2 X 65,681,680 - 65,717,404 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 65,683,232 - 65,721,748 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 67,170,441 - 67,171,854 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 70,670,833 - 70,672,246 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 68,231,732 - 68,233,145 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 70,421,599 - 70,447,109 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 70,426,951 - 70,428,364 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 71,296,545 - 71,329,324 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 88,589,534 - 88,590,947 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 88,662,966 - 88,664,380 (-) NCBI Celera X 66,045,899 - 66,047,312 (-) NCBI Celera Cytogenetic Map X q22 NCBI
P2RY4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 70,258,166 - 70,260,204 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 70,258,166 - 70,260,204 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 69,478,016 - 69,480,054 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 69,394,741 - 69,396,379 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 69,261,247 - 69,262,675 NCBI Celera X 69,831,353 - 69,832,991 (-) NCBI Celera Cytogenetic Map X q13.1 NCBI HuRef X 63,299,114 - 63,300,752 (-) NCBI HuRef CHM1_1 X 69,371,994 - 69,373,632 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 68,691,490 - 68,693,528 (-) NCBI T2T-CHM13v2.0
P2ry4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 99,631,964 - 99,638,533 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 99,633,760 - 99,638,475 (-) Ensembl GRCm39 Ensembl GRCm38 X 100,588,358 - 100,594,927 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 100,590,154 - 100,594,869 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 97,785,493 - 97,790,208 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 96,792,873 - 96,797,588 (-) NCBI MGSCv36 mm8 Celera X 87,516,188 - 87,520,903 (-) NCBI Celera Cytogenetic Map X C3 NCBI cM Map X 43.72 NCBI
P2ry4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955475 9,800,541 - 9,802,055 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955475 9,794,538 - 9,802,055 (-) NCBI ChiLan1.0 ChiLan1.0
P2RY4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 69,935,449 - 69,937,488 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 69,939,051 - 69,941,090 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 59,526,621 - 59,528,248 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 69,585,984 - 69,587,611 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 69,586,340 - 69,587,437 (-) Ensembl panpan1.1 panPan2
P2RY4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 54,706,404 - 54,707,512 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 45,532,412 - 45,533,520 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 55,672,553 - 55,673,661 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 X 53,641,532 - 53,642,640 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 54,972,339 - 54,973,447 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 54,899,511 - 54,900,619 (-) NCBI UU_Cfam_GSD_1.0
P2ry4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 47,455,684 - 47,457,937 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936762 1,217,858 - 1,218,950 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936762 1,217,858 - 1,218,948 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
P2RY4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 56,279,346 - 56,286,400 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 56,284,736 - 56,285,833 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 63,479,522 - 63,480,619 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
P2RY4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 60,099,961 - 60,104,094 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 60,102,265 - 60,103,362 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666065 1,948,078 - 1,950,108 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
P2ry4
.
Predicted Target Of
Count of predictions: 75 Count of miRNA genes: 66 Interacting mature miRNAs: 71 Transcripts: ENSRNOT00000045907 Prediction methods: Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 61431 Cia19 Collagen induced arthritis QTL 19 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 65612192 120568734 Rat 738035 Stresp1 Stress response QTL 1 4.96 0.000011 stress-related behavior trait (VT:0010451) defensive burying - coping X 41304447 112935181 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
48
113
91
90
59
25
59
6
216
96
93
44
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000045907 ⟹ ENSRNOP00000039027
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 65,686,252 - 65,721,748 (-) Ensembl Rnor_6.0 Ensembl X 70,426,951 - 70,428,364 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096316 ⟹ ENSRNOP00000094459
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 65,683,232 - 65,721,748 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099755 ⟹ ENSRNOP00000085052
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 65,686,252 - 65,721,604 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112073 ⟹ ENSRNOP00000082634
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 65,683,232 - 65,721,748 (-) Ensembl
RefSeq Acc Id:
NM_031680 ⟹ NP_113868
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,727,113 - 69,728,526 (-) NCBI mRatBN7.2 X 65,687,032 - 65,688,445 (-) NCBI Rnor_6.0 X 70,426,951 - 70,428,364 (-) NCBI Rnor_5.0 X 71,296,545 - 71,329,324 (-) NCBI RGSC_v3.4 X 88,589,534 - 88,590,947 (-) RGD Celera X 66,045,899 - 66,047,312 (-) RGD
Sequence:
AAGCTCTGTCTGATGCCATCAGTCCCTGGGCTGGACTAAGGAAGCTAGGGGGCCATGACCAGTGCAGAATCCTTGCTATTCACATCACTAGGTCCCAGCCCAAGTTCTGGAGATGGTGATTGTAGGTT
hide sequence
RefSeq Acc Id:
XM_039100005 ⟹ XP_038955933
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,745,513 (-) NCBI mRatBN7.2 X 65,681,680 - 65,705,437 (-) NCBI
RefSeq Acc Id:
XM_039100006 ⟹ XP_038955934
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,752,295 (-) NCBI mRatBN7.2 X 65,681,680 - 65,707,199 (-) NCBI
RefSeq Acc Id:
XM_039100007 ⟹ XP_038955935
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,754,368 (-) NCBI mRatBN7.2 X 65,681,680 - 65,717,382 (-) NCBI
RefSeq Acc Id:
XM_039100009 ⟹ XP_038955937
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,757,726 (-) NCBI mRatBN7.2 X 65,681,680 - 65,717,382 (-) NCBI
RefSeq Acc Id:
XM_039100011 ⟹ XP_038955939
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,754,368 (-) NCBI mRatBN7.2 X 65,681,680 - 65,717,382 (-) NCBI
RefSeq Acc Id:
XM_039100012 ⟹ XP_038955940
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,757,726 (-) NCBI mRatBN7.2 X 65,681,680 - 65,717,382 (-) NCBI
RefSeq Acc Id:
XM_039100014 ⟹ XP_038955942
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,754,368 (-) NCBI mRatBN7.2 X 65,681,680 - 65,717,382 (-) NCBI
RefSeq Acc Id:
XM_039100015 ⟹ XP_038955943
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,757,726 (-) NCBI mRatBN7.2 X 65,681,680 - 65,717,404 (-) NCBI
RefSeq Acc Id:
XM_063280273 ⟹ XP_063136343
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,752,295 (-) NCBI
RefSeq Acc Id:
XM_063280274 ⟹ XP_063136344
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,754,368 (-) NCBI
RefSeq Acc Id:
XM_063280275 ⟹ XP_063136345
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,757,726 (-) NCBI
RefSeq Acc Id:
XM_063280276 ⟹ XP_063136346
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,722,604 - 69,752,295 (-) NCBI
RefSeq Acc Id:
NP_113868 ⟸ NM_031680
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
- Sequence:
MTSAESLLFTSLGPSPSSGDGDCRFNEEFKFILLPMSYAVVFVLGLALNAPTLWLFLFRLRPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGLCKFVRFLFYWNLYCSVLFLTCISVH
hide sequence
Ensembl Acc Id:
ENSRNOP00000039027 ⟸ ENSRNOT00000045907
RefSeq Acc Id:
XP_038955943 ⟸ XM_039100015
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955940 ⟸ XM_039100012
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955937 ⟸ XM_039100009
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955942 ⟸ XM_039100014
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955939 ⟸ XM_039100011
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955935 ⟸ XM_039100007
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955934 ⟸ XM_039100006
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955933 ⟸ XM_039100005
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085052 ⟸ ENSRNOT00000099755
Ensembl Acc Id:
ENSRNOP00000082634 ⟸ ENSRNOT00000112073
Ensembl Acc Id:
ENSRNOP00000094459 ⟸ ENSRNOT00000096316
RefSeq Acc Id:
XP_063136345 ⟸ XM_063280275
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063136344 ⟸ XM_063280274
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063136346 ⟸ XM_063280276
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063136343 ⟸ XM_063280273
- Peptide Label:
isoform X1
- UniProtKB:
O35811 (UniProtKB/Swiss-Prot), A6IQ78 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
P2ry4
pyrimidinergic receptor P2Y4
P2ry4
pyrimidinergic receptor P2Y, G-protein coupled, 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
P2ry4
pyrimidinergic receptor P2Y, G-protein coupled, 4
purinergic receptor P2Y, G-protein coupled 4
Name updated
1299863 APPROVED
2002-06-10
P2ry4
purinergic receptor P2Y, G-protein coupled 4
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_cellular_localization
localized to the apical plasma membrane and basolateral domains
628452
gene_expression
mRNA present in holangiocytes, hepatocytes and epithelial cells
628452
gene_process
may mediate vasomotor responses, neurotransmission, platelet aggregation, and secretion
628452
gene_regulation
receptor activity is suramin-insensitive
628452
