Symbol:
Sycp1
Name:
synaptonemal complex protein 1
RGD ID:
3794
Description:
Predicted to enable double-stranded DNA binding activity. Predicted to be involved in meiosis I cell cycle process and protein homotetramerization. Predicted to act upstream of or within regulation of protein localization and sperm DNA condensation. Located in transverse filament. Orthologous to human SYCP1 (synaptonemal complex protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2-ethoxyethanol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A coiled-coil related protein specific for synapsed regions of meiotic prophase chromosomes; SCP-1; SCP1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 192,985,164 - 193,145,234 (-) NCBI GRCr8 mRatBN7.2 2 190,296,688 - 190,456,687 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 190,296,954 - 190,456,737 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 197,911,191 - 198,053,355 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 195,771,767 - 195,913,691 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 190,600,884 - 190,743,044 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 205,274,766 - 205,426,869 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 205,274,769 - 205,426,869 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 224,746,025 - 224,857,015 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 2 224,707,701 - 224,725,381 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 197,989,614 - 198,164,611 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 197,952,370 - 198,127,365 (-) NCBI Celera 2 182,717,279 - 182,930,195 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sycp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SYCP1 mRNA CTD PMID:32109520 Sycp1 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression EXP 6480464 2 more ... CTD PMID:32109520 Sycp1 Rat 2-ethoxyethanol decreases expression EXP 6480464 2-ethoxyethanol results in decreased expression of SYCP1 mRNA CTD PMID:19643169 Sycp1 Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of SYCP1 mRNA CTD PMID:19643169 Sycp1 Rat 2-methoxyethanol decreases expression EXP 6480464 methyl cellosolve results in decreased expression of SYCP1 mRNA CTD PMID:19643169 Sycp1 Rat 3,3',5-triiodo-L-thyronine decreases expression ISO Sycp1 (Mus musculus) 6480464 Triiodothyronine results in decreased expression of SYCP1 mRNA CTD PMID:34571837 Sycp1 Rat 3,3',5-triiodo-L-thyronine multiple interactions ISO Sycp1 (Mus musculus) 6480464 [Chlorpyrifos co-treated with Triiodothyronine] results in decreased expression of SYCP1 mRNA and [Ethylenethiourea co-treated with Triiodothyronine] results in decreased expression of SYCP1 mRNA CTD PMID:34571837 Sycp1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SYCP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SYCP1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SYCP1 mRNA CTD PMID:28628672 Sycp1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO SYCP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SYCP1 mRNA CTD PMID:28628672 Sycp1 Rat 5-aza-2'-deoxycytidine affects expression ISO SYCP1 (Homo sapiens) 6480464 Decitabine affects the expression of SYCP1 mRNA CTD PMID:18240144 Sycp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SYCP1 mRNA CTD PMID:16483693 Sycp1 Rat arsane affects methylation ISO SYCP1 (Homo sapiens) 6480464 Arsenic affects the methylation of SYCP1 gene CTD PMID:25304211 Sycp1 Rat arsenic atom affects methylation ISO SYCP1 (Homo sapiens) 6480464 Arsenic affects the methylation of SYCP1 gene CTD PMID:25304211 Sycp1 Rat benzene decreases expression ISO Sycp1 (Mus musculus) 6480464 Benzene results in decreased expression of SYCP1 mRNA CTD PMID:36306860 Sycp1 Rat benzo[a]pyrene affects methylation ISO SYCP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SYCP1 exon and Benzo(a)pyrene affects the methylation of SYCP1 promoter CTD PMID:27901495 Sycp1 Rat benzo[e]pyrene increases methylation ISO SYCP1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of SYCP1 intron CTD PMID:30157460 Sycp1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Sycp1 (Mus musculus) 6480464 [Diethylhexyl Phthalate results in increased methylation of SYCP1 promoter] which results in decreased expression of SYCP1 mRNA CTD PMID:34319233 Sycp1 Rat bis(2-ethylhexyl) phthalate increases methylation ISO Sycp1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased methylation of SYCP1 gene and Diethylhexyl Phthalate results in increased methylation of SYCP1 promoter CTD PMID:34319233 Sycp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SYCP1 mRNA CTD PMID:25181051 Sycp1 Rat bisphenol A decreases expression ISO Sycp1 (Mus musculus) 6480464 bisphenol A results in decreased expression of SYCP1 mRNA CTD PMID:32156529 Sycp1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SYCP1 protein CTD PMID:24552547 Sycp1 Rat Bisphenol A diglycidyl ether affects expression ISO Sycp1 (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the expression of SYCP1 mRNA CTD PMID:36464114 Sycp1 Rat bisphenol AF affects expression ISO Sycp1 (Mus musculus) 6480464 bisphenol AF affects the expression of SYCP1 mRNA CTD PMID:36464114 Sycp1 Rat bisphenol F multiple interactions ISO SYCP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SYCP1 mRNA CTD PMID:28628672 Sycp1 Rat cadmium dichloride decreases expression ISO Sycp1 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of SYCP1 mRNA CTD PMID:24982889 Sycp1 Rat cetrorelix multiple interactions ISO SYCP1 (Homo sapiens) 6480464 [cetrorelix co-treated with testosterone enanthate co-treated with Desogestrel] results in decreased expression of SYCP1 mRNA and [cetrorelix co-treated with testosterone enanthate] results in decreased expression of SYCP1 mRNA CTD PMID:18160741 Sycp1 Rat CGP 52608 multiple interactions ISO SYCP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SYCP1 gene] CTD PMID:28238834 Sycp1 Rat chlorpyrifos decreases expression ISO Sycp1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of SYCP1 mRNA CTD PMID:34571837 and PMID:36769379 Sycp1 Rat chlorpyrifos multiple interactions ISO Sycp1 (Mus musculus) 6480464 [Chlorpyrifos co-treated with Triiodothyronine] results in decreased expression of SYCP1 mRNA CTD PMID:34571837 Sycp1 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of SYCP1 mRNA CTD PMID:35605701 Sycp1 Rat desogestrel multiple interactions ISO SYCP1 (Homo sapiens) 6480464 [cetrorelix co-treated with testosterone enanthate co-treated with Desogestrel] results in decreased expression of SYCP1 mRNA CTD PMID:18160741 Sycp1 Rat dexamethasone multiple interactions ISO SYCP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SYCP1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SYCP1 mRNA CTD PMID:28628672 Sycp1 Rat Ethylenethiourea decreases expression ISO Sycp1 (Mus musculus) 6480464 Ethylenethiourea results in decreased expression of SYCP1 mRNA CTD PMID:34571837 Sycp1 Rat Ethylenethiourea multiple interactions ISO Sycp1 (Mus musculus) 6480464 [Ethylenethiourea co-treated with Triiodothyronine] results in decreased expression of SYCP1 mRNA CTD PMID:34571837 Sycp1 Rat flavone increases expression ISO SYCP1 (Homo sapiens) 6480464 flavone results in increased expression of SYCP1 protein CTD PMID:14750173 Sycp1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of SYCP1 mRNA CTD PMID:18035473 Sycp1 Rat fonofos increases methylation ISO SYCP1 (Homo sapiens) 6480464 Fonofos results in increased methylation of SYCP1 promoter CTD PMID:22847954 Sycp1 Rat indometacin multiple interactions ISO SYCP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SYCP1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SYCP1 mRNA CTD PMID:28628672 Sycp1 Rat lipopolysaccharide multiple interactions ISO SYCP1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of SYCP1 mRNA CTD PMID:35811015 Sycp1 Rat manganese(II) chloride increases expression ISO Sycp1 (Mus musculus) 6480464 manganese chloride results in increased expression of SYCP1 mRNA CTD PMID:15295902 Sycp1 Rat methapyrilene increases methylation ISO SYCP1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of SYCP1 intron CTD PMID:30157460 Sycp1 Rat N(4)-hydroxycytidine decreases expression ISO Sycp1 (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of SYCP1 mRNA CTD PMID:37748715 Sycp1 Rat paracetamol increases expression ISO SYCP1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SYCP1 mRNA CTD PMID:22230336 Sycp1 Rat parathion increases methylation ISO SYCP1 (Homo sapiens) 6480464 Parathion results in increased methylation of SYCP1 promoter CTD PMID:22847954 Sycp1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of SYCP1 mRNA CTD PMID:12832660 Sycp1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SYCP1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of SYCP1 mRNA CTD PMID:35811015 Sycp1 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO SYCP1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of SYCP1 mRNA CTD PMID:35811015 Sycp1 Rat terbufos increases methylation ISO SYCP1 (Homo sapiens) 6480464 terbufos results in increased methylation of SYCP1 promoter CTD PMID:22847954 Sycp1 Rat testosterone enanthate multiple interactions ISO SYCP1 (Homo sapiens) 6480464 [cetrorelix co-treated with testosterone enanthate co-treated with Desogestrel] results in decreased expression of SYCP1 mRNA and [cetrorelix co-treated with testosterone enanthate] results in decreased expression of SYCP1 mRNA CTD PMID:18160741 Sycp1 Rat titanium dioxide increases methylation ISO Sycp1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of SYCP1 gene CTD PMID:35295148 Sycp1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of SYCP1 mRNA CTD PMID:33387578 Sycp1 Rat trovafloxacin increases expression ISO Sycp1 (Mus musculus) 6480464 trovafloxacin results in increased expression of SYCP1 mRNA CTD PMID:35537566 Sycp1 Rat valproic acid increases expression ISO SYCP1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SYCP1 mRNA CTD PMID:24935251 and PMID:28001369 Sycp1 Rat valproic acid increases methylation ISO SYCP1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SYCP1 gene CTD PMID:29154799 Sycp1 Rat zearalenone increases expression ISO Sycp1 (Mus musculus) 6480464 Zearalenone results in increased expression of SYCP1 mRNA CTD PMID:24412631
2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-ethoxyethanol (EXP) 2-methoxyethanol (EXP) 3,3',5-triiodo-L-thyronine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) bisphenol F (ISO) cadmium dichloride (ISO) cetrorelix (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cypermethrin (EXP) desogestrel (ISO) dexamethasone (ISO) Ethylenethiourea (ISO) flavone (ISO) flavonoids (EXP) fonofos (ISO) indometacin (ISO) lipopolysaccharide (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) N(4)-hydroxycytidine (ISO) paracetamol (ISO) parathion (ISO) pirinixic acid (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) terbufos (ISO) testosterone enanthate (ISO) titanium dioxide (ISO) trichloroethene (EXP) trovafloxacin (ISO) valproic acid (ISO) zearalenone (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Characterization of a novel meiosis-specific protein within the central element of the synaptonemal complex.
Hamer G, etal., J Cell Sci. 2006 Oct 1;119(Pt 19):4025-32. Epub 2006 Sep 12.
4.
A coiled-coil related protein specific for synapsed regions of meiotic prophase chromosomes.
Meuwissen RL, etal., EMBO J 1992 Dec;11(13):5091-100.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Organization of SCP1 protein molecules within synaptonemal complexes of the rat.
Schmekel K, etal., Exp Cell Res. 1996 Jul 10;226(1):20-30.
11.
Proteomics profiling of nuclear proteins for kidney fibroblasts suggests hypoxia, meiosis, and cancer may meet in the nucleus.
Shakib K, etal., Proteomics. 2005 Jul;5(11):2819-38.
Sycp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 192,985,164 - 193,145,234 (-) NCBI GRCr8 mRatBN7.2 2 190,296,688 - 190,456,687 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 190,296,954 - 190,456,737 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 197,911,191 - 198,053,355 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 195,771,767 - 195,913,691 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 190,600,884 - 190,743,044 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 205,274,766 - 205,426,869 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 205,274,769 - 205,426,869 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 224,746,025 - 224,857,015 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 2 224,707,701 - 224,725,381 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 197,989,614 - 198,164,611 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 197,952,370 - 198,127,365 (-) NCBI Celera 2 182,717,279 - 182,930,195 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
SYCP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 114,854,088 - 114,995,370 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 114,854,863 - 114,995,370 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 115,397,484 - 115,537,991 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 115,198,978 - 115,339,514 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 115,109,496 - 115,250,030 NCBI Celera 1 113,626,675 - 113,767,206 (+) NCBI Celera Cytogenetic Map 1 p13.2 NCBI HuRef 1 113,255,798 - 113,396,257 (+) NCBI HuRef CHM1_1 1 115,512,661 - 115,653,225 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 114,865,527 - 115,006,795 (+) NCBI T2T-CHM13v2.0
Sycp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 102,725,815 - 102,843,416 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 102,725,815 - 102,843,416 (-) Ensembl GRCm39 Ensembl GRCm38 3 102,818,499 - 102,936,100 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 102,818,499 - 102,936,100 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 102,622,422 - 102,740,023 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 102,947,711 - 103,065,145 (-) NCBI MGSCv36 mm8 Celera 3 105,025,122 - 105,140,873 (-) NCBI Celera Cytogenetic Map 3 F2.2 NCBI cM Map 3 45.25 NCBI
Sycp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955435 18,157,173 - 18,291,732 (+) NCBI ChiLan1.0 ChiLan1.0
SYCP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 107,508,119 - 107,651,051 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 107,102,971 - 107,250,205 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 87,565,888 - 87,701,530 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 122,614,169 - 122,754,797 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 122,614,520 - 122,754,137 (-) Ensembl panpan1.1 panPan2
SYCP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 52,538,909 - 52,681,495 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 52,539,615 - 52,648,133 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 52,185,713 - 52,295,690 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 53,416,396 - 53,526,463 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 53,417,228 - 53,526,125 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 52,450,471 - 52,560,463 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 52,492,758 - 52,603,152 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 53,066,281 - 53,176,061 (+) NCBI UU_Cfam_GSD_1.0
Sycp1
SYCP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 105,591,743 - 105,730,398 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 105,592,354 - 105,730,413 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 115,731,010 - 115,869,676 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SYCP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 18,712,236 - 18,827,120 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 18,712,587 - 18,823,277 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 21,463,980 - 21,577,606 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sycp1
.
Predicted Target Of
Count of predictions: 46 Count of miRNA genes: 40 Interacting mature miRNAs: 45 Transcripts: ENSRNOT00000023333 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 61458 Bp10 Blood pressure QTL 10 3.42 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 4889834 Pur24 Proteinuria QTL 24 5.8 0.014 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 2 184114274 202447032 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 185876309 219753474 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298083 Bp158 Blood pressure QTL 158 2.62 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 189599258 218414891 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 7488929 Bp366 Blood pressure QTL 366 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 184974550 193094998 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
D2Rat233
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 193,001,627 - 193,001,762 (+) Marker Load Pipeline mRatBN7.2 2 190,313,133 - 190,313,268 (+) MAPPER mRatBN7.2 Rnor_6.0 2 205,288,167 - 205,288,301 NCBI Rnor6.0 Rnor_5.0 2 224,721,102 - 224,721,236 UniSTS Rnor5.0 RGSC_v3.4 2 198,010,041 - 198,010,434 RGD RGSC3.4 RGSC_v3.4 2 198,010,112 - 198,010,246 UniSTS RGSC3.4 RGSC_v3.1 2 197,972,866 - 197,973,000 RGD Celera 2 182,732,543 - 182,732,677 UniSTS RH 3.4 Map 2 1301.7 UniSTS RH 3.4 Map 2 1301.7 RGD RH 2.0 Map 2 976.9 RGD SHRSP x BN Map 2 74.0098 RGD Cytogenetic Map 2 q34 UniSTS
D2Got129
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 190,457,112 - 190,457,378 (+) MAPPER mRatBN7.2 Rnor_6.0 2 205,427,295 - 205,427,560 NCBI Rnor6.0 Rnor_5.0 2 224,857,441 - 224,857,706 UniSTS Rnor5.0 RGSC_v3.4 2 198,165,036 - 198,165,302 RGD RGSC3.4 RGSC_v3.4 2 198,165,037 - 198,165,302 UniSTS RGSC3.4 RGSC_v3.1 2 198,127,791 - 198,128,056 RGD Celera 2 182,930,621 - 182,930,886 UniSTS RH 3.4 Map 2 1315.9 UniSTS RH 3.4 Map 2 1315.9 RGD RH 2.0 Map 2 992.3 RGD Cytogenetic Map 2 q34 UniSTS
L18248
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 190,417,342 - 190,418,323 (+) MAPPER mRatBN7.2 Rnor_6.0 2 205,387,523 - 205,388,503 NCBI Rnor6.0 Rnor_5.0 2 224,817,633 - 224,818,613 UniSTS Rnor5.0 RGSC_v3.4 2 198,123,005 - 198,123,985 UniSTS RGSC3.4 Celera 2 182,831,279 - 182,832,259 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
9
6
47
54
54
25
21
25
6
102
45
28
16
51
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023333 ⟹ ENSRNOP00000023333
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 190,296,954 - 190,456,737 (-) Ensembl Rnor_6.0 Ensembl 2 205,274,769 - 205,426,869 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102018 ⟹ ENSRNOP00000078830
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 190,296,954 - 190,456,737 (-) Ensembl
RefSeq Acc Id:
NM_012810 ⟹ NP_036942
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 192,985,181 - 193,145,180 (-) NCBI mRatBN7.2 2 190,296,688 - 190,456,687 (-) NCBI Rnor_6.0 2 205,274,766 - 205,426,869 (-) NCBI Rnor_5.0 2 224,707,701 - 224,725,381 (-) NCBI Rnor_5.0 2 224,746,025 - 224,857,015 (-) NCBI RGSC_v3.4 2 197,989,614 - 198,164,611 (-) RGD Celera 2 182,717,279 - 182,930,195 (-) RGD
Sequence:
GGAATTCGGCACGAGTCGGGCTTCTAGGAGGTTCTGAGGCAGAAGCTCTCAGTTCCATTCGATGTCTTCATAAAGAAGCGCTCGCGGGCACGGAGCCTGCCATCGGGCCATGGAGAAGCAGAAGCCTT
hide sequence
RefSeq Acc Id:
XM_063281327 ⟹ XP_063137397
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 192,985,164 - 193,145,234 (-) NCBI
RefSeq Acc Id:
XM_063281328 ⟹ XP_063137398
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 192,985,164 - 193,145,227 (-) NCBI
RefSeq Acc Id:
XM_063281330 ⟹ XP_063137400
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 192,985,164 - 193,145,216 (-) NCBI
RefSeq Acc Id:
XM_063281331 ⟹ XP_063137401
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 192,985,164 - 193,145,227 (-) NCBI
RefSeq Acc Id:
XM_063281332 ⟹ XP_063137402
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 192,985,164 - 193,145,216 (-) NCBI
RefSeq Acc Id:
XM_063281333 ⟹ XP_063137403
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 192,985,164 - 193,145,227 (-) NCBI
RefSeq Acc Id:
XM_063281334 ⟹ XP_063137404
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 192,985,164 - 193,145,073 (-) NCBI
RefSeq Acc Id:
XM_063281335 ⟹ XP_063137405
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 192,985,164 - 193,134,382 (-) NCBI
RefSeq Acc Id:
XM_063281336 ⟹ XP_063137406
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 192,985,164 - 193,111,359 (-) NCBI
RefSeq Acc Id:
NP_036942 ⟸ NM_012810
- UniProtKB:
Q03410 (UniProtKB/Swiss-Prot)
- Sequence:
MSSLSKNRENIDTDPAFQKLSILPMLEQVANSGSCHYQEGVNDSDFENSEPMSRLYSKLYKEAEKIKKWKVSIESELKQKENKLQENRKIIEAQRKAIQELQFENEKVSLKLEEEIQENKDLIKENNA
hide sequence
Ensembl Acc Id:
ENSRNOP00000023333 ⟸ ENSRNOT00000023333
Ensembl Acc Id:
ENSRNOP00000078830 ⟸ ENSRNOT00000102018
RefSeq Acc Id:
XP_063137397 ⟸ XM_063281327
- Peptide Label:
isoform X1
- UniProtKB:
Q03410 (UniProtKB/Swiss-Prot), A6K3J6 (UniProtKB/TrEMBL), F1LS76 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137398 ⟸ XM_063281328
- Peptide Label:
isoform X2
- UniProtKB:
Q03410 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137401 ⟸ XM_063281331
- Peptide Label:
isoform X3
- UniProtKB:
Q03410 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137403 ⟸ XM_063281333
- Peptide Label:
isoform X5
- UniProtKB:
Q03410 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137400 ⟸ XM_063281330
- Peptide Label:
isoform X2
- UniProtKB:
Q03410 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137402 ⟸ XM_063281332
- Peptide Label:
isoform X4
- UniProtKB:
Q03410 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137404 ⟸ XM_063281334
- Peptide Label:
isoform X6
- UniProtKB:
Q03410 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137405 ⟸ XM_063281335
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_063137406 ⟸ XM_063281336
- Peptide Label:
isoform X8
RGD ID: 13691622 Promoter ID: EPDNEW_R2147 Type: single initiation site Name: Sycp1_1 Description: synaptonemal complex protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 205,426,883 - 205,426,943 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Sycp1
Synaptonemal complex protein 1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_domains
contains leucine zipper domain, sever S/T-P-C-C motifs (chracteristic of DNA-binding proteins), and a potential binding site for p34cdc2 protein kinases
729937
gene_protein
protein contains 946 aa residues and has a molecular weight of 111 kDa
729937
